Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_047007399.1 AAW01_RS11525 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_001010925.1:WP_047007399.1 Length = 255 Score = 117 bits (293), Expect = 4e-31 Identities = 78/223 (34%), Positives = 115/223 (51%), Gaps = 13/223 (5%) Query: 4 IQLTDLTKRFGDTVA----VDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGD 59 I+L D+TK FG A + + + I+ +F+ ++GPSG GKSTT+ +L L+ PTSG Sbjct: 22 IELRDITKTFGTGAAAFQALKGVDMTIERGDFVAVMGPSGSGKSTTMNILGCLDVPTSGT 81 Query: 60 IYIGGDHMN------YRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDE 113 G + + + R + VFQ + L + +N+ L G T +R E Sbjct: 82 FRFRGVEVQDLSRDQRSLLRRRYLGFVFQGFNLLARTSALENVELPLLYR-GETKKQRRE 140 Query: 114 RVVEVAETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEM 173 + +G+ D P ELSGGQQQRVA+ RA+V DP+V L DEP NLD + E+ Sbjct: 141 AAERSLDLVGLLPWADHTPAELSGGQQQRVAIARALVTDPDVLLADEPTGNLDTERSVEI 200 Query: 174 RTELQNLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQV 216 L L +Q +T + VTH + E A I DG +++V Sbjct: 201 MELLTEL-NQRGITVLMVTH-EDEMAQFAKTIVHFRDGLVERV 241 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 255 Length adjustment: 27 Effective length of query: 356 Effective length of database: 228 Effective search space: 81168 Effective search space used: 81168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory