Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_047006727.1 AAW01_RS07155 ATP-binding cassette domain-containing protein
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_001010925.1:WP_047006727.1 Length = 255 Score = 128 bits (321), Expect = 2e-34 Identities = 78/206 (37%), Positives = 116/206 (56%), Gaps = 8/206 (3%) Query: 23 AVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVLNGVSAQD--R 80 AV+ +SL+I GEF+ LVG SG GKST L+ + L EG ++++ + G+ + R Sbjct: 23 AVDTVSLEIGAGEFVALVGASGSGKSTLLKCVNRLVEPDEGSVQIDGQDTAGLPPAESRR 82 Query: 81 DIAMVFQSYALYPHKSVRGNMSFGLE-ESTGLPDDEIRQRVEETTDMLGIS-DLLDRKPG 138 I VFQ L+PH +V N++ ES L D R+ E ++ + ++ R P Sbjct: 83 RIGYVFQGIGLFPHLTVAQNIALPSRLESNALSAD----RIAELLALVELEPEMAQRMPS 138 Query: 139 QLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTH 198 +LSGGQ+QRV + RA+ + + LMDEP LD R E+ ++RL +L +TTV VTH Sbjct: 139 ELSGGQRQRVGVARALSSESHLLLMDEPFGALDPLTRGELGKRVRRLHDQLHLTTVLVTH 198 Query: 199 DQTEAMTMGDRVAVLDDGELQQVGTP 224 D EA+ + RV V+D G + TP Sbjct: 199 DMAEALLLATRVLVMDSGRIVADETP 224 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 255 Length adjustment: 27 Effective length of query: 356 Effective length of database: 228 Effective search space: 81168 Effective search space used: 81168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory