Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_047007470.1 AAW01_RS11975 succinylglutamate-semialdehyde dehydrogenase
Query= BRENDA::P76217 (492 letters) >NCBI__GCF_001010925.1:WP_047007470.1 Length = 481 Score = 418 bits (1074), Expect = e-121 Identities = 217/457 (47%), Positives = 300/457 (65%), Gaps = 5/457 (1%) Query: 15 ASRVKRNPVSGEVLWQGNDADAAQVEQACRAARAAFPRWARLSFAERHAVVERFAALLES 74 A + P +G LW+ + V++ AR A+P WA A+R +V RF + + Sbjct: 14 AELISYEPATGAELWRQRHGN---VDEYVARARKAWPGWAAEPLAKRIELVRRFVNEVRA 70 Query: 75 NKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMP-DGAASLRHR 133 + E +I+RETGKP WEA TEV A++ K+ ISI AY RTG+++ + G+A+LRH+ Sbjct: 71 EQDEFAQLISRETGKPLWEARTEVEAVMAKVDISITAYAERTGQRKLDSALQGSAALRHK 130 Query: 134 PHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEAVMRLWQQAGLPPGV 193 PHGV+AV GPYNFP HLPNGHIVPAL+AGN II KPSE TP GE ++ + +AG+P V Sbjct: 131 PHGVMAVLGPYNFPAHLPNGHIVPALIAGNAIILKPSEKTPAVGERLLSFFHKAGIPQDV 190 Query: 194 LNLVQGGRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKILALEMGGNNPLIID 253 + + GG + G+AL A D+DG+LFTGSA G ++R+L+ P K++ALEMGGNNP+++ Sbjct: 191 VQCLIGGPDEGKALVAHADVDGVLFTGSAQVGIAINRKLASNPGKMVALEMGGNNPIVLW 250 Query: 254 EVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLARLVAVSQRLTPGNWDDE 313 + ++ A L IQSAF TAGQRCT RRL++KS + DA L + ++ RL + Sbjct: 251 DTPKLEDAAALIIQSAFTTAGQRCTAGRRLIVKS-SMYDAALEAVTKLTDRLLVDEPFAD 309 Query: 314 PQPFIGGLISEQAAQQVVTAWQQLEAMGGRPLLAPRLLQAGTSLLTPGIIEMTGVAGVPD 373 P PF+G +I Q A Q+ ++ L + GG+ + R L+P II+ T +A PD Sbjct: 310 PAPFMGPVIDNQTADQLTESFLYLLSNGGKAIKHLRRPHGDLPFLSPSIIDTTNMAERPD 369 Query: 374 EEVFGPLLRVWRYDTFDEAIRMANNTRFGLSCGLVSPEREKFDQLLLEARAGIVNWNKPL 433 E+FGP+L+V R D FD AI ANNTRFGLS L+ + +++++ RAGIVNWN+P Sbjct: 370 VELFGPILQVVRVDDFDAAIAEANNTRFGLSASLIGGDPKQYNRFWANIRAGIVNWNRPT 429 Query: 434 TGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASLE 470 GA+S APFGGIG SGNHRP+A+YAADYCA+P+ S E Sbjct: 430 NGASSAAPFGGIGLSGNHRPAAFYAADYCAYPVTSTE 466 Lambda K H 0.318 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 650 Number of extensions: 32 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 481 Length adjustment: 34 Effective length of query: 458 Effective length of database: 447 Effective search space: 204726 Effective search space used: 204726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory