Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate WP_047006204.1 AAW01_RS05300 TRAP transporter large permease
Query= uniprot:Q88NP0 (426 letters) >NCBI__GCF_001010925.1:WP_047006204.1 Length = 426 Score = 367 bits (942), Expect = e-106 Identities = 190/422 (45%), Positives = 279/422 (66%) Query: 1 MEAFILLGSFIVLILIGMPVAYALGLSALIGAWWIDIPLQAMMIQVASGVNKFSLLAIPF 60 ME +LL VL+ IG+PVA+ALG +++ +DIP+ ++A+ +N F+L+AIPF Sbjct: 1 MELTVLLLLLAVLLAIGVPVAFALGAASVATFLLLDIPVVVAFQRMAASMNVFTLMAIPF 60 Query: 61 FVLAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSV 120 FV AG +MA G++ RLV A G RGGL V++ AS FGA+SGS+VA +++GS Sbjct: 61 FVFAGDLMARTGIAERLVRVAEGAFGRARGGLGQVDVGASMMFGAVSGSAVASVSAMGST 120 Query: 121 LIPEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGL 180 L+P M+ KGY +++ VT++ ++ +L PPSHN ++Y+ A+ +VS+ LF+AGI+PGL Sbjct: 121 LMPMMKEKGYDADYAVNVTITAAILGILIPPSHNMIIYAAASPVSVSVGDLFLAGIVPGL 180 Query: 181 LLSAVMMGLCLIFAKKRNYPKGEVIPLREALKIAGEALWGLMAMVIILGGILSGVFTATE 240 L A +M + A +R YP G R K A GLM +II+ GIL GVFT TE Sbjct: 181 LAGAALMFVAWRVAIRRGYPGGTFPGWRSFTKSLIAAFPGLMTALIIVFGILLGVFTPTE 240 Query: 241 SAAVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPS 300 S+AVAV+++ + + +YR + + VRT ++VM++IG A FG++ L+ P Sbjct: 241 SSAVAVIYTIVIGVLVYRSLGYIAFVEAASSAVRTTAMVMLIIGTAGMFGWLFALLHGPE 300 Query: 301 KITTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGM 360 ++ +S + VI++ I +L++LG MDMAPLI+I TPI LPV GVDPVHFG+ Sbjct: 301 MLSGGLTAVSQDPAVIMLMILLVLLVLGAFMDMAPLIIITTPIFLPVAVATGVDPVHFGI 360 Query: 361 IMLVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLW 420 IM+++LGIGL+TPPVG+VLFVG A+G+ E V+ + PFYLAL +VL+ V Y+P++SLW Sbjct: 361 IMMLSLGIGLVTPPVGSVLFVGCAVGQAKPEQVVRTIWPFYLALMIVLLLVAYLPSLSLW 420 Query: 421 LP 422 LP Sbjct: 421 LP 422 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 26 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 426 Length adjustment: 32 Effective length of query: 394 Effective length of database: 394 Effective search space: 155236 Effective search space used: 155236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory