Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_047006469.1 AAW01_RS01810 phosphate ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_001010925.1:WP_047006469.1 Length = 280 Score = 135 bits (339), Expect = 1e-36 Identities = 91/243 (37%), Positives = 139/243 (57%), Gaps = 21/243 (8%) Query: 18 FGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLE---PISG--GRLEVAGVDL 72 +G + + V+ +IY + V + IGPSGCGKSTFLR LNR+ P + GR+E+ G D+ Sbjct: 42 YGDKRAIDDVSIDIYTEYVTAFIGPSGCGKSTFLRALNRMNDTIPSASVKGRIELDGDDI 101 Query: 73 SGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPR----KVLRIPMAEAKDRAL 128 + +D + QLR RVGMVFQ N FP ++ +N+ PR R + E +++L Sbjct: 102 YASGMD---VVQLRARVGMVFQKPNPFPK-SIYENIAYGPRIHGLAENRNDVDEIVEKSL 157 Query: 129 TYLDKVGLGTKA-DNYPDQ---LSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGE 184 + GL + D D LSGGQ+QR+ IAR + + PE++L DEP SALDP + Sbjct: 158 R---RAGLWEEVKDRLQDSGTALSGGQQQRLCIARAIAVDPEVILMDEPCSALDPIATAK 214 Query: 185 VLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRA 244 + ++ +L + +VTH MQ A VS R FF+ G + E G +++F NP+ R + Sbjct: 215 IEELIDELRGR-YGIVIVTHSMQQAARVSQRTAFFHLGKMVEYGHTSDIFTNPREKRTQD 273 Query: 245 FLS 247 +++ Sbjct: 274 YIT 276 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 280 Length adjustment: 25 Effective length of query: 227 Effective length of database: 255 Effective search space: 57885 Effective search space used: 57885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory