Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate WP_047005877.1 AAW01_RS03230 ABC transporter ATP-binding protein
Query= uniprot:Q6MNM2 (347 letters) >NCBI__GCF_001010925.1:WP_047005877.1 Length = 226 Score = 132 bits (331), Expect = 1e-35 Identities = 79/222 (35%), Positives = 118/222 (53%), Gaps = 11/222 (4%) Query: 2 AKIQFSNIKKSFGSADV----LKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADS 57 A + N+ +SF DV L+G+DLD+ PGE + L+G SG GKST+L+ + LE Sbjct: 6 AVVSLRNLTRSFQQGDVRIDVLRGVDLDVGPGEIVALLGQSGSGKSTMLQAVGLLEGGFG 65 Query: 58 GTISIDGKKINDIEPQNRD------IAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEIT 111 G+I I GK+ + ++ R + V+Q + L P T EN+ L AE Sbjct: 66 GSIRIAGKEASQLDAAERTSLRREHLGFVYQFHHLLPDFTAQENVVLPQLLLGTKRAEAE 125 Query: 112 KRVNEISELLQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQ 171 R E+ L ++H L +P +LSGG++QRVA+ RAL+ + ++L DEP NLD + Sbjct: 126 LRAQELLGSLGLEHRLTHRPSKLSGGEQQRVAVARALANKPQLVLADEPTGNLDEKTSER 185 Query: 172 MRLEIKRLHHNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIE 213 + E L S + TH++ A + DR+ L DGVIE Sbjct: 186 VLSEFLELVRGQGSAALVATHNERLAARM-DRVVRLHDGVIE 226 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 226 Length adjustment: 26 Effective length of query: 321 Effective length of database: 200 Effective search space: 64200 Effective search space used: 64200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory