Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_047005877.1 AAW01_RS03230 ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_001010925.1:WP_047005877.1 Length = 226 Score = 119 bits (297), Expect = 9e-32 Identities = 75/220 (34%), Positives = 116/220 (52%), Gaps = 11/220 (5%) Query: 4 ITLRNVQKRFGEAVV----IPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQ 59 ++LRN+ + F + V + +DLD+ GE V +G SG GKST+L+ + LE G Sbjct: 8 VSLRNLTRSFQQGDVRIDVLRGVDLDVGPGEIVALLGQSGSGKSTMLQAVGLLEGGFGGS 67 Query: 60 IMIDGRDATEMPPAKRG------LAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERR 113 I I G++A+++ A+R L V+Q + L P T ++N+ P + + E E R Sbjct: 68 IRIAGKEASQLDAAERTSLRREHLGFVYQFHHLLPDFTAQENVVLPQLLLGTKRAEAELR 127 Query: 114 VSNAAKILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMR 173 L L + L RP +LSGG++QRVA+ RA+ +P L DEP NLD + Sbjct: 128 AQELLGSLGLEHRLTHRPSKLSGGEQQRVAVARALANKPQLVLADEPTGNLDEKTSERVL 187 Query: 174 LEITELHQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIE 213 E EL + + + TH++ A M D++V L+ G IE Sbjct: 188 SEFLELVRGQGSAALVATHNERLAARM-DRVVRLHDGVIE 226 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 226 Length adjustment: 25 Effective length of query: 307 Effective length of database: 201 Effective search space: 61707 Effective search space used: 61707 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory