Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_047007752.1 AAW01_RS12300 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::Q00384 (208 letters) >NCBI__GCF_001010925.1:WP_047007752.1 Length = 202 Score = 220 bits (560), Expect = 2e-62 Identities = 115/197 (58%), Positives = 142/197 (72%), Gaps = 1/197 (0%) Query: 4 IDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIKIMKEVPGAV 63 I+ VM+ APV+PVLV++DI A+ AEALV GGL VLEVTLRT ALEAIK M VPGA+ Sbjct: 5 IEDVMQTAPVIPVLVVDDIGHARETAEALVEGGLKVLEVTLRTDDALEAIKRMNLVPGAI 64 Query: 64 VGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLG 123 VGAGTV N + A +AG EF VSPGLT LG+ AV LPG ANA D+M GLDLG Sbjct: 65 VGAGTVTNPDQMKAALDAGSEFIVSPGLTKPLGEAAVKSGIPFLPGTANAGDIMRGLDLG 124 Query: 124 LDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPTSAPKYLENPSILCVGGSWVVP 183 L FKFFPA GG+PALK++A+ F Q +FCPTGGI+ +AP++L + + CVGGSWV P Sbjct: 125 LTHFKFFPATAAGGIPALKALAAPFGQCKFCPTGGISAETAPEWLAHDFVYCVGGSWVAP 184 Query: 184 AGKPDVAKITALAKEAS 200 +G +I+ LA+EA+ Sbjct: 185 SG-ASPEQISQLAREAA 200 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 208 Length of database: 202 Length adjustment: 21 Effective length of query: 187 Effective length of database: 181 Effective search space: 33847 Effective search space used: 33847 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory