Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_047005877.1 AAW01_RS03230 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_001010925.1:WP_047005877.1 Length = 226 Score = 78.6 bits (192), Expect = 1e-19 Identities = 60/190 (31%), Positives = 94/190 (49%), Gaps = 6/190 (3%) Query: 18 IQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIEYLGQP---LKGK 74 I ++G+DL+V GE+V L+G +G+GK+T L+A+ G L G I G+ L Sbjct: 24 IDVLRGVDLDVGPGEIVALLGQSGSGKSTMLQAV-GLLEGG-FGGSIRIAGKEASQLDAA 81 Query: 75 KSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKWFAVFPRLKERA 134 + L ++ L V + + + QEN+++ K A + L+ R Sbjct: 82 ERTSLRREHLGFVYQFHHLLPDFTAQENVVLPQLLLGTKRAEAELRAQELLGSLGLEHRL 141 Query: 135 AQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIF-EVIRNVSAQGITI 193 LSGGEQQ +A+ARAL + P+L+L DEP+ L E++ E + V QG Sbjct: 142 THRPSKLSGGEQQRVAVARALANKPQLVLADEPTGNLDEKTSERVLSEFLELVRGQGSAA 201 Query: 194 LLVEQNAKLA 203 L+ N +LA Sbjct: 202 LVATHNERLA 211 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 226 Length adjustment: 23 Effective length of query: 218 Effective length of database: 203 Effective search space: 44254 Effective search space used: 44254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory