Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_047005555.1 AAW01_RS01220 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_001010925.1:WP_047005555.1 Length = 254 Score = 109 bits (273), Expect = 5e-29 Identities = 79/263 (30%), Positives = 129/263 (49%), Gaps = 37/263 (14%) Query: 14 VTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQS-------------SGNYNFWPTDI 60 VTG + GIG +I L QGA + + +G DK ++ +G++ ++ Sbjct: 11 VTGASGGIGSSIAYALAKQGARLALSGSNG-DKLRAFREQLIADCGSPEAGDHVEITCNL 69 Query: 61 SSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQ 120 S ++V + + I G +D LVNNAG+ L + + + +E+++ +N Sbjct: 70 SDTTQVEELIPAAIDTLGGLDILVNNAGITRDNLAM---------RMKDEEWEQVIQVNL 120 Query: 121 KGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGK 180 + VF + +A AR M+K R G I+N++S G G+ GQ Y A KA + ++S ++EL Sbjct: 121 EAVFRLMRASARPMMKARFGRIINITSVVGTTGNPGQMNYCAAKAGVVGMSKSLAQELAA 180 Query: 181 HGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVAD 240 GI V VAPG + EAL + ++ IP+GR G ++ Sbjct: 181 RGITVNCVAPGFIRSA------MTEAL--------DDKQKDAINGRIPMGRMGEGGDIGA 226 Query: 241 FVCYLLSERASYMTGVTTNIAGG 263 V YL S+ ASY+TG T ++ GG Sbjct: 227 AVAYLASKEASYVTGQTLHVNGG 249 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 254 Length adjustment: 24 Effective length of query: 243 Effective length of database: 230 Effective search space: 55890 Effective search space used: 55890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory