Protein WP_047092247.1 in Erythrobacter marinus HWDM-33
Annotation: NCBI__GCF_001013305.1:WP_047092247.1
Length: 216 amino acids
Source: GCF_001013305.1 in NCBI
Candidate for 31 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 36% | 51% | 124.8 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 36% | 51% | 124.8 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 38% | 52% | 124 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 36% | 50% | 123.2 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-cellobiose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-glucose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| lactose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-maltose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-mannose catabolism | TT_C0211 | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| sucrose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| sucrose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| trehalose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 36% | 51% | 120.9 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 37% | 52% | 119.8 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-maltose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 38% | 51% | 119.4 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| sucrose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 38% | 51% | 119.4 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| trehalose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 38% | 51% | 119.4 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| L-arabinose catabolism | xacJ | lo | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 35% | 53% | 117.5 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 55% | 116.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 55% | 116.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 55% | 116.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 55% | 116.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 55% | 116.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 55% | 116.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-cellobiose catabolism | SMc04256 | lo | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 35% | 56% | 113.2 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| glycerol catabolism | glpT | lo | ABC transporter for Glycerol, ATPase component 2 (characterized) | 34% | 51% | 97.8 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| L-arginine catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 34% | 77% | 97.1 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| L-glutamate catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 34% | 77% | 97.1 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| L-histidine catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 34% | 77% | 97.1 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| L-valine catabolism | livG | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 34% | 77% | 97.1 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| D-alanine catabolism | AZOBR_RS08245 | lo | Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) | 34% | 72% | 91.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
| L-proline catabolism | AZOBR_RS08245 | lo | Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) | 34% | 72% | 91.3 | ModC aka CHLD aka NARD aka B0765, component of Molybdate porter consisting of three proteins | 46% | 171.0 |
Sequence Analysis Tools
View WP_047092247.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSFDVDLELTLGDQRIAIAFASDAKLAALVGPSGAGKTSVLNAISGLLKPSSGRVAVAGN
MLFDSAAKLDVPPDQRRAGYVFQDARLFPHRRVSANLAYGEKLARPAEVWITRGEVCDLL
EIGALLDRWPATLSGGETRRVAIARALLAAPKFLLLDEPLSSLDPARAERLAALIERIRD
ELAIPILLVSHSASEVERLADQVVTMPSPSERPIDS
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory