Align Aldehyde dehydrogenase; EC 1.2.1.3 (characterized)
to candidate WP_047093797.1 AAV99_RS09860 coniferyl aldehyde dehydrogenase
Query= SwissProt::P12693 (483 letters) >NCBI__GCF_001013305.1:WP_047093797.1 Length = 479 Score = 307 bits (787), Expect = 5e-88 Identities = 180/456 (39%), Positives = 258/456 (56%), Gaps = 24/456 (5%) Query: 39 IAERIAALNLLKETIQR-------REPEIIAALAADFRKPASEVK--LTEIFPVLQEINH 89 IA R AL++ ++ + R + + A++ D+ SEV+ LT+I ++ + Sbjct: 23 IAARPEALSIRRDRLDRTIALLADNDKALCDAMSEDYGN-RSEVQSMLTDILVSIRFAKY 81 Query: 90 AKRNLKDWMKP--RRVRAALSVAGTRAGLRYEPKGVCLIIAPWNYPFNLSFGPLVSALAA 147 + + W KP R V+ L + G +A +RYEPKGV II+PWN+P NL+FGPL LAA Sbjct: 82 CREKMAHWAKPDSRSVQFPLGLLGAKAEVRYEPKGVVGIISPWNFPVNLAFGPLAQVLAA 141 Query: 148 GNSVVIKPSELTPHTATLIGSIVREAFSVDLVAVVEGDAAVSQELLALPFDHIFFTGSPR 207 GN +IKPSE TP TA LI +V F VAV G V++ ALPFDH+ FTGS Sbjct: 142 GNRAMIKPSESTPTTANLIAELVGARFDAHEVAVATGGVDVAKAFSALPFDHLVFTGSTE 201 Query: 208 VGKLVMEAASKTLASVTLELGGKSPTIIGPTANLPKAARNIVWGKFSNNGQTCIAPDHVF 267 G+ VMEAA L VTLELGGKSP IIG +A+L + IV GK N GQ CIAPD++ Sbjct: 202 TGRKVMEAAGTNLTPVTLELGGKSPAIIGASADLERTGSRIVTGKMMNAGQICIAPDYLL 261 Query: 268 VHRCIAQKFNEILVKEIVRVYGKDFAAQRRSADYCRIVNDQHFNRINKLLTDAKAKGAKI 327 V + + ++ + + R + DY ++ND ++R+ +++ DA+ KG + Sbjct: 262 V----PESMEDGVIASLELGVLDQYPTVRDNPDYASVINDSQYSRLQEMVADARDKGGDV 317 Query: 328 LQ----GGQVDATERLVVP-TVLSNVTAAMDINHEEIFGPLLPIIEYDDIDSVIKRVNDG 382 ++ G A+ +P T++ N T M EEIFGP+LP+ Y ID I+ +NDG Sbjct: 318 MEINPAGEDFSASNTRKMPLTIIRNPTPDMQAMQEEIFGPVLPVKTYRGIDEAIQFINDG 377 Query: 383 DKPLALYVFSEDKQFVNNIVARTSSGSVGVNLSVVHFLHPNLPFGGVNNSGIGSAHGVYG 442 +PLALY F D + +++RT SG V VN + H ++PFGGV SGIG+ HGV G Sbjct: 378 GRPLALYYFGNDSAERDAVLSRTISGGVTVNDVIFHNTVEDMPFGGVGASGIGAYHGVEG 437 Query: 443 FRAFSHEKPVLID-KFSITHW--LFPPYTKKVKQLI 475 FR FSH + V K + L PPY + ++++ Sbjct: 438 FREFSHARAVYTQPKIDVAGMAGLKPPYGDRARKML 473 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 479 Length adjustment: 34 Effective length of query: 449 Effective length of database: 445 Effective search space: 199805 Effective search space used: 199805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory