Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_082126415.1 AAV99_RS08705 phosphate ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_001013305.1:WP_082126415.1 Length = 283 Score = 142 bits (357), Expect = 9e-39 Identities = 87/245 (35%), Positives = 136/245 (55%), Gaps = 12/245 (4%) Query: 2 IKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEK--PNG---G 56 ++ +S +G + + +S + V A IGPSG GKSTFLR LN + P+ G Sbjct: 36 MRARDVSVYYGNKKAIDEVSVDVFSEYVTAFIGPSGCGKSTFLRALNRMNDTIPSARVEG 95 Query: 57 TITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAP-VNVKKESKQAAQE 115 TI + +I + +++R +GMVFQ + FP K++ +N+ Y P ++ E K Sbjct: 96 TIELDGEDIYSSGMDVVQLRARVGMVFQKPNPFP-KSIYDNVAYGPKIHGLAEGKTELDA 154 Query: 116 KAEDLLRKVGLFE----KRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEM 171 E L + GL+E + D LSGGQ+QR+ IARA+A++P+++L DEP SALDP Sbjct: 155 IVEKSLTRAGLWEEVKDRLQDSGTALSGGQQQRLCIARAIAVDPEVILMDEPCSALDPIA 214 Query: 172 VKEVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKR 231 + +++ +L +VIVTH M A V+ R F G +VE G+ + F +PK +R Sbjct: 215 TARIEELIDDL-RGRYAIVIVTHSMQQAARVSQRTAFFHLGHLVEYGHTSDIFTNPKQQR 273 Query: 232 AQDFL 236 QD++ Sbjct: 274 TQDYI 278 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 283 Length adjustment: 25 Effective length of query: 215 Effective length of database: 258 Effective search space: 55470 Effective search space used: 55470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory