Align ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized)
to candidate WP_047092815.1 AAV99_RS05500 cell division ATP-binding protein FtsE
Query= reanno::pseudo1_N1B4:Pf1N1B4_774 (244 letters) >NCBI__GCF_001013305.1:WP_047092815.1 Length = 256 Score = 139 bits (349), Expect = 7e-38 Identities = 80/217 (36%), Positives = 127/217 (58%), Gaps = 4/217 (1%) Query: 1 MISIKNVNKWYG-DFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVI 59 ++ NV YG D +VL+D S + G + G SG+GK++++K + + +G + Sbjct: 8 IVQFANVGLRYGTDREVLSDISFTLYPGSFYFLTGASGAGKTSMLKLLYLAQRPSRGIIS 67 Query: 60 VDGTSIAD-PKTNLPKLRSRVGMVFQHFELFPHLSIMDNLTIAQVKVLGRSKEEASKKAL 118 + G + P+ LP +R R+G+VFQ F L PHLS DN+ + +++ G S+E K Sbjct: 68 MFGEDVITLPRNCLPGVRRRIGVVFQDFRLVPHLSTFDNVALP-LRISGMSEERLQKPVA 126 Query: 119 QLLERVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDV 178 +LE VGL ++ P LSGG+QQR AIARA+ P +++ DEPT +DPEM ++L + Sbjct: 127 DMLEWVGLDHRSEARPETLSGGEQQRAAIARAVIARPEILVADEPTGNVDPEMAVKLLRL 186 Query: 179 MVQLAHEGMTMMCVTHEMGFARKVADRVIF-MDQGKI 214 L G T++ TH++ RKV D +I +D+GK+ Sbjct: 187 FEALNRLGTTVVVATHDVHLLRKVPDSLIMRLDKGKL 223 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 256 Length adjustment: 24 Effective length of query: 220 Effective length of database: 232 Effective search space: 51040 Effective search space used: 51040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory