Align ATPase (characterized, see rationale)
to candidate WP_047094562.1 AAV99_RS12760 ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_001013305.1:WP_047094562.1 Length = 246 Score = 140 bits (354), Expect = 2e-38 Identities = 87/205 (42%), Positives = 119/205 (58%), Gaps = 10/205 (4%) Query: 34 QFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLS-HDRRD 92 Q AL GV +++GEV+V++GPSGSGKSTFL + L+ G ++ L+ RD Sbjct: 32 QVHALRGVDFDIRKGEVLVLLGPSGSGKSTFLNIVGGLDRSTSGTLYYAAENLTAKSDRD 91 Query: 93 IATIR-QEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQA 151 + R Q +G +FQ +NL P LT +N+ L + P+ AEA L V +AE+ Sbjct: 92 LTRFRRQRIGFIFQFYNLIPSLTAEENVRLV-TDIASNPMDPAEA-----LHHVGLAERR 145 Query: 152 DKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLASE-GMTM 210 +P QLSGG+QQRVA+ARA+A +P +LL DEPT ALD VL+ + E T+ Sbjct: 146 HHFPAQLSGGEQQRVAVARAIAKRPGVLLCDEPTGALDSSTGIRVLEALEAANRELDTTL 205 Query: 211 LVATHEVGFAREVADRVVLMADGQI 235 L+ TH G A +ADRV DGQI Sbjct: 206 LIITHNAGIA-AMADRVFHFLDGQI 229 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 246 Length adjustment: 24 Effective length of query: 237 Effective length of database: 222 Effective search space: 52614 Effective search space used: 52614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory