Align Solute carrier family 13 member 2 (Na /di- and tricarboxylate cotransporter 1) (NaDC-1) (Renal sodium/dicarboxylate cotransporter) (characterized)
to candidate WP_047094455.1 AAV99_RS12860 C4-dicarboxylate ABC transporter
Query= TCDB::Q13183 (592 letters) >NCBI__GCF_001013305.1:WP_047094455.1 Length = 502 Score = 219 bits (559), Expect = 2e-61 Identities = 168/542 (30%), Positives = 258/542 (47%), Gaps = 75/542 (13%) Query: 19 FVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTALFPLILFPMMGIVDASEV 78 F LLLP P + A ++ MA +W T+A+PL T L P + P + A+EV Sbjct: 15 FALTLLLPAPAGMIGPAWNTAGLVMWMATWWMTQAIPLTATGLLPFAVLPFVSAGTANEV 74 Query: 79 AVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVRPAP--LILGFMLVTAFLS 136 A +Y L GG +A+A+E LHKR+A +L +G R L+LGFM+ A LS Sbjct: 75 AGDYYSPIIFLLLGGAFLALAIERTGLHKRLACWILDRIGGRGGEFGLLLGFMIAAAILS 134 Query: 137 MWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQA 196 ISNT+T+ +M+P+A AVL ASS E + E QKE Sbjct: 135 NIISNTSTALIMMPMALAVLS---GGAASSCNEVIGQKGSTSCNEVIGQKE--------- 182 Query: 197 LPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQ 256 RA + L+ + + + ++ASIGG+ T+ G+ N + + + Sbjct: 183 ---------SRADGTLDQSGLSGALPMGLAFAASIGGLGTIIGSPTNAIGVALLRDI--- 230 Query: 257 NGNVVNFASWFSFAFPTMVILLLLAWLWLQILFLGFNFRKNFGIGEKMQEQQQAAYCVIQ 316 +G + FA W F P ++ + LA + I K+Q + + Sbjct: 231 SGIEITFAQWAMFGVPIVIAGIPLAAV----------------IIAKVQRIADHPFDLSA 274 Query: 317 TEHRLL--GPMTFAEKAISILFVILVLLWFTREPGFFLGWGNLAFPNAKGESMVSDGTVA 374 + GP + AE+ + + + L W R GF + FP E ++DGTVA Sbjct: 275 ARKAIAPQGPWSEAERRLVPVIAVTFLAWMLR--GFVAPY----FP----EGSLTDGTVA 324 Query: 375 IFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWNIVLLLGGGYALAKG 434 I ++F +P + G+ LL+W+ N + PW+++++ GGG ALA Sbjct: 325 IAAAFLLFTLP----------DGTGRR-----LLEWREAN-RAPWDVLMMFGGGLALAGA 368 Query: 435 SERSGLSEWLGNKLTPLQSVPAPAIAIILSLLVATFTECTSNVATTTIFLPILASMAQAI 494 R+GL++WLGN L PL VP IA+ L +V TE SNVAT + +P++A++A AI Sbjct: 369 MTRTGLADWLGNALLPLAGVPVIVIALALVAMVILITEFASNVATASGIMPVVAALAVAI 428 Query: 495 CLHP-----LYVMLPCTLATSLAFMLPVATPPNAIVFSFGDLKVLDMARAGFLLNIIGVL 549 L + +P LA S F+LP T PNAI +S G + + + +AG L+I G+ Sbjct: 429 SGESGGNVVLLLAMPVALAASWGFVLPAGTGPNAIAWSTGRIALPRLIKAGITLDIAGIF 488 Query: 550 II 551 +I Sbjct: 489 LI 490 Lambda K H 0.325 0.138 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 790 Number of extensions: 41 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 592 Length of database: 502 Length adjustment: 35 Effective length of query: 557 Effective length of database: 467 Effective search space: 260119 Effective search space used: 260119 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory