Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_047093195.1 AAV99_RS05720 enoyl-CoA hydratase
Query= reanno::psRCH2:GFF2389 (257 letters) >NCBI__GCF_001013305.1:WP_047093195.1 Length = 260 Score = 119 bits (297), Expect = 8e-32 Identities = 83/253 (32%), Positives = 128/253 (50%), Gaps = 3/253 (1%) Query: 4 ETLLVDIQERVALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAKAFAA 63 + L + + +A ITLN P LN+L +++ L A+ Q D CIV+TG+ +AF Sbjct: 6 DELQYSVVDNIARITLNAPDKLNSLAPAMLTGLVAAIAQAHEDGA-RCIVITGTGRAFCT 64 Query: 64 GADIK-EMAELTYPQIYLDDFFADADR-IATRRKPLIAAVAGYALGGGCELALLCDMIFA 121 GA + A ++ ++ A R +A P++ ++ G A G G AL D++ A Sbjct: 65 GARLDPSFAGDGDLGAVIEKYYDPAARAMADSDIPIVTSLNGIAAGAGLGFALSGDIVIA 124 Query: 122 ADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVFP 181 A +A+ +G++P G T L ++VG+AKA++M L +M A +A GL+ARV Sbjct: 125 ARSAQLLCAFARIGLVPDAGTTWMLAQSVGRAKALEMMLLAEEMSAEDAAAQGLIARVVD 184 Query: 182 AESLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATADQKE 241 E+L ET K A +A A MI++ V E L + ER T D +E Sbjct: 185 DEALEAETAKVAAKLAAMPTKALGMIRKQVRATLEGDLENSLAAERGHQTIAGKTHDFRE 244 Query: 242 GMAAFSEKRKPEF 254 G+ AF +KR P F Sbjct: 245 GVMAFIQKRLPSF 257 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 260 Length adjustment: 24 Effective length of query: 233 Effective length of database: 236 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory