Align crotonase (EC 4.2.1.150) (characterized)
to candidate WP_047094365.1 AAV99_RS12275 enoyl-CoA hydratase/isomerase family protein
Query= metacyc::MONOMER-13469 (259 letters) >NCBI__GCF_001013305.1:WP_047094365.1 Length = 252 Score = 114 bits (284), Expect = 3e-30 Identities = 82/258 (31%), Positives = 130/258 (50%), Gaps = 15/258 (5%) Query: 5 NIILEKDGNVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGS--GKAFV 62 N+ LE DG VA + ++R NA N A + + + D V ++I + G F Sbjct: 2 NLRLEFDGPVAHLLIDRLDKRNAFNMAMWEAMPGLLEQARADPAVRTLVIRSAQPGGVFC 61 Query: 63 AGADIAEM---KDLTAVEGRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCD 119 AGADI EM KD A + + N++ L L P +A + G +GGGC ++++CD Sbjct: 62 AGADIKEMLLHKDDGAWLAANQAAI-NRVQHDLARLTLPTVAFVEGDCVGGGCGIAIACD 120 Query: 120 IRIASSKAKFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVN 179 +R+A+ KA+FG LGI + L +G G AK +++TG +++A EA RIGLV Sbjct: 121 LRVATDKARFGITPGKLGIVYPLHDVKLLTDLVGPGQAKRMLFTGGLLDAAEAQRIGLV- 179 Query: 180 KVVEPDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEA-EVFGECFAT 238 + + + + L++ I+ +P ++R K + + L D TG + +F + F Sbjct: 180 -----EMIADSPRGLLNDILSASPHSIREIKMFVRRVL--DGQTGDDDQTLAIFTDAFMR 232 Query: 239 EDRVEGMTAFVEKRDKAF 256 D EG AF KR F Sbjct: 233 GDFAEGAAAFAGKRKPDF 250 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 252 Length adjustment: 24 Effective length of query: 235 Effective length of database: 228 Effective search space: 53580 Effective search space used: 53580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory