Align Alcohol dehydrogenase; EC 1.1.1.1; EC 1.1.1.4; EC 1.2.1.3 (characterized)
to candidate WP_047094432.1 AAV99_RS12695 NAD(P)-dependent alcohol dehydrogenase
Query= SwissProt::Q0KDL6 (366 letters) >NCBI__GCF_001013305.1:WP_047094432.1 Length = 354 Score = 494 bits (1271), Expect = e-144 Identities = 254/359 (70%), Positives = 292/359 (81%), Gaps = 7/359 (1%) Query: 5 MKAAVFVEPGRIELADKPIPDIGPNDALVRITTTTICGTDVHILKGEYPVAKGLTVGHEP 64 MKAA+FVEPGRI L +KP+PD+GP DAL++ITTTTICGTDVHILKGEYPV KGLTVGHEP Sbjct: 1 MKAAIFVEPGRIVLGEKPVPDVGPLDALMKITTTTICGTDVHILKGEYPVEKGLTVGHEP 60 Query: 65 VGIIEKLGSAVTGYREGQRVIAGAICPNFNSYAAQDGVASQDGSYLMASGQCGCHGYKAT 124 VG IEKLGSAV G+ EGQRVIAGAI P+ S A+ G +Q G GQ G HG+KA Sbjct: 61 VGRIEKLGSAVYGFTEGQRVIAGAITPSGTSTASLCGFHAQCG------GQEG-HGWKAI 113 Query: 125 AGWRFGNMIDGTQAEYVLVPDAQANLTPIPDGLTDEQVLMCPDIMSTGFKGAENANIRIG 184 GWRFGN IDG QAEY+LVPDA ANL PIPDGL+DEQVLMCPDIMSTGF GAE+ IRIG Sbjct: 114 GGWRFGNTIDGAQAEYLLVPDAMANLAPIPDGLSDEQVLMCPDIMSTGFGGAESGKIRIG 173 Query: 185 DTVAVFAQGPIGLCATAGARLCGATTIIAIDGNDHRLEIARKMGADVVLNFRNCDVVDEV 244 DTVAVFAQGPIGL ATAGA + GATTII ++ R+ ++R+MGA V++F D VDE+ Sbjct: 174 DTVAVFAQGPIGLFATAGAYMMGATTIIGVESIPARMAMSRQMGATHVVDFSKVDPVDEI 233 Query: 245 MKLTGGRGVDASIEALGTQATFEQSLRVLKPGGTLSSLGVYSSDLTIPLSAFAAGLGDHK 304 MK+T GRGVD +IEALG Q+TFE +LRVL+PGGTLSSLGVYS DLTIP AF+AGLGD+ Sbjct: 234 MKITDGRGVDVAIEALGLQSTFEGALRVLRPGGTLSSLGVYSGDLTIPCDAFSAGLGDNH 293 Query: 305 INTALCPGGKERMRRLINVIESGRVDLGALVTHQYRLDDIVAAYDLFANQRDGVLKIAI 363 I T LCPGGKERMRRL+ + SGR+D ALVTH++ LD IV AY+LFANQR GVLK+AI Sbjct: 294 IVTTLCPGGKERMRRLMATVASGRIDTKALVTHRFPLDSIVDAYELFANQRGGVLKVAI 352 Lambda K H 0.320 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 354 Length adjustment: 29 Effective length of query: 337 Effective length of database: 325 Effective search space: 109525 Effective search space used: 109525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory