Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_047094592.1 AAV99_RS13340 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_001013305.1:WP_047094592.1 Length = 224 Score = 130 bits (328), Expect = 2e-35 Identities = 83/216 (38%), Positives = 127/216 (58%), Gaps = 17/216 (7%) Query: 28 LEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILLDGESIGYHEVNGK 87 ++VL GV+LT++ G +V L+G SGSGK+T+L+ V +LE G+I + G+ + Sbjct: 22 IDVLNGVNLTIEPGEIVALVGPSGSGKSTMLQAVGLLEGGFSGKIEIAGQDASTLD---- 77 Query: 88 RVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLHKDEAVVLAEKWLER 147 S + R G +Q +L P TA +N+ L L + + + +AVV AE+ L Sbjct: 78 ----SAERTTLRRDHLGFVYQFHHLLPDFTARENIVLPQLLLG-VSRADAVVRAEQLLGA 132 Query: 148 VGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPE----LVGEVLSVI 203 +GL R DH P +LSGG+QQRVA+ARA+A P L+L DE T LD + ++GE L ++ Sbjct: 133 LGLEHRMDHRPSKLSGGEQQRVAVARALANKPQLVLADEPTGNLDEKTSERVLGEFLELV 192 Query: 204 KGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIE 239 +G G L+ TH R A + D++V +++GRIE Sbjct: 193 RG---QGSAALVATHNERLAARM-DRVVRLHEGRIE 224 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 224 Length adjustment: 24 Effective length of query: 241 Effective length of database: 200 Effective search space: 48200 Effective search space used: 48200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory