Align GluA aka CGL1950, component of Glutamate porter (characterized)
to candidate WP_082126415.1 AAV99_RS08705 phosphate ABC transporter ATP-binding protein
Query= TCDB::P48243 (242 letters) >NCBI__GCF_001013305.1:WP_082126415.1 Length = 283 Score = 142 bits (359), Expect = 5e-39 Identities = 91/241 (37%), Positives = 135/241 (56%), Gaps = 14/241 (5%) Query: 7 VQKYFGDFHALTDIDLEIPRGQVVVVLGPSGSGKSTLCRTINRL-ETIE----EGTIEID 61 V Y+G+ A+ ++ +++ V +GPSG GKST R +NR+ +TI EGTIE+D Sbjct: 41 VSVYYGNKKAIDEVSVDVFSEYVTAFIGPSGCGKSTFLRALNRMNDTIPSARVEGTIELD 100 Query: 62 GKVLPEEGKGLANLRADVGMVFQSFNLFPHLTIKDNVTLAPIKVRKMK--KSEAEKLAMS 119 G+ + G + LRA VGMVFQ N FP +I DNV P K+ + K+E + + Sbjct: 101 GEDIYSSGMDVVQLRARVGMVFQKPNPFPK-SIYDNVAYGP-KIHGLAEGKTELDAIVEK 158 Query: 120 LLERVG----IANQADKYPAQLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMVNEV 175 L R G + ++ LSGGQQQR+ IARA+A++P+++L DEP SALDP + Sbjct: 159 SLTRAGLWEEVKDRLQDSGTALSGGQQQRLCIARAIAVDPEVILMDEPCSALDPIATARI 218 Query: 176 LDVMASLAKEGMTMVCVTHEMGFARKAADRVLFMADGLIVEDTEPDSFFTNPKSDRAKDF 235 +++ L + +V VTH M A + + R F G +VE FTNPK R +D+ Sbjct: 219 EELIDDL-RGRYAIVIVTHSMQQAARVSQRTAFFHLGHLVEYGHTSDIFTNPKQQRTQDY 277 Query: 236 L 236 + Sbjct: 278 I 278 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 283 Length adjustment: 25 Effective length of query: 217 Effective length of database: 258 Effective search space: 55986 Effective search space used: 55986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory