Align ABC transporter related (characterized, see rationale)
to candidate WP_047094592.1 AAV99_RS13340 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_001013305.1:WP_047094592.1 Length = 224 Score = 130 bits (327), Expect = 2e-35 Identities = 84/215 (39%), Positives = 124/215 (57%), Gaps = 18/215 (8%) Query: 23 VLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLAGEELKMKRRGDGKL 82 VL G++L G++++++G SGSGKST L+ + LLE G + +AG+ D Sbjct: 24 VLNGVNLTIEPGEIVALVGPSGSGKSTMLQAVGLLEGGFSGKIEIAGQ--------DAST 75 Query: 83 QPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRSRAESVEEAEALLAKV 142 S R R R LG V+Q +L T EN++ P + SRA++V AE LL + Sbjct: 76 LDSAERTTLR-RDHLGFVYQFHHLLPDFTARENIVL-PQLLLGVSRADAVVRAEQLLGAL 133 Query: 143 GLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDPE----LVGEVLRVMR 198 GL + H P+ LSGG+QQRVA+ARALA P+++L DEPT LD + ++GE L ++R Sbjct: 134 GLEHRMDHRPSKLSGGEQQRVAVARALANKPQLVLADEPTGNLDEKTSERVLGEFLELVR 193 Query: 199 SLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVE 233 +G LV TH A + +RV+ LH+G++E Sbjct: 194 G---QGSAALVATHNERLAARM-DRVVRLHEGRIE 224 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 224 Length adjustment: 23 Effective length of query: 240 Effective length of database: 201 Effective search space: 48240 Effective search space used: 48240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory