Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_082126415.1 AAV99_RS08705 phosphate ABC transporter ATP-binding protein
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_001013305.1:WP_082126415.1 Length = 283 Score = 120 bits (302), Expect = 2e-32 Identities = 90/259 (34%), Positives = 129/259 (49%), Gaps = 22/259 (8%) Query: 5 KLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEK--PS---E 59 K+ D+ YG + + VS+ + V + IG SG GKSTFLR +N + PS E Sbjct: 35 KMRARDVSVYYGNKKAIDEVSVDVFSEYVTAFIGPSGCGKSTFLRALNRMNDTIPSARVE 94 Query: 60 GSIVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAP-I 118 G+I ++G+ I + + LR R+ MVFQ N + ++ +NV P I Sbjct: 95 GTIELDGEDI-----------YSSGMDVVQLRARVGMVFQKPNPFPK-SIYDNVAYGPKI 142 Query: 119 QVLGLSKQEARERAVKYLAKVGIDERAQGKYP---VHLSGGQQQRVSIARALAMEPEVLL 175 L K E K L + G+ E + + LSGGQQQR+ IARA+A++PEV+L Sbjct: 143 HGLAEGKTELDAIVEKSLTRAGLWEEVKDRLQDSGTALSGGQQQRLCIARAIAVDPEVIL 202 Query: 176 FDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGA 235 DEP SALDP + ++ L +V+VTH M A VS F H G + E G Sbjct: 203 MDEPCSALDPIATARIEELIDDLRGR-YAIVIVTHSMQQAARVSQRTAFFHLGHLVEYGH 261 Query: 236 PEQLFGNPQSPRLQRFLKG 254 +F NP+ R Q ++ G Sbjct: 262 TSDIFTNPKQQRTQDYITG 280 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 283 Length adjustment: 25 Effective length of query: 232 Effective length of database: 258 Effective search space: 59856 Effective search space used: 59856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory