Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_047092227.1 AAV99_RS01725 ROK family protein
Query= curated2:Q9KCZ4 (330 letters) >NCBI__GCF_001013305.1:WP_047092227.1 Length = 289 Score = 93.2 bits (230), Expect = 7e-24 Identities = 96/324 (29%), Positives = 136/324 (41%), Gaps = 53/324 (16%) Query: 9 VDVGGTTIKMAFLTTAGEIVDKWEIPTNKQDGGALITTNIADALDKRLSGHHKSKSDLIG 68 ++ GGT +A +G I + EIPT + +A+A + +S+ + Sbjct: 5 IEAGGTKFVLAVGHASGAIAARHEIPTRTPE------ETLAEA-----ASWIQSQGPVAA 53 Query: 69 IGLGAPGFIEMDT-----GFIYHAVNIGWRDFPLKDKLEEETKLPVIVDNDANIAALGEM 123 IG+ A G ++D G I GW + ++PV D D N AALGE Sbjct: 54 IGIAAFGPAQLDRNAADWGHILGTPKPGWTHCDIAGYFANRFEIPVGFDTDVNGAALGEY 113 Query: 124 WKGAGDGAKNMLLITLGTGVGGGIVANGNILHGVNGMAGEIGHITVIPEGGAPCNCG--- 180 GAG M IT+GTG+GGGI+ NG I+HGV+ E+GH E G Sbjct: 114 RLGAGRMTGGMAYITVGTGIGGGIIVNGEIVHGVS--HPEMGHFYPRREASDRAFAGVCP 171 Query: 181 -KTGCLETVASATGIARIATEGVTEHKESQLALDYDKHGVLTAKDVFSAADASDAFALSV 239 CLE +AS G A +A G S L D++ HG+ Sbjct: 172 YHGDCLEGLAS--GPAILARWG---RNLSDLPDDHEAHGL-------------------- 206 Query: 240 VDHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYALPRVADGAEFR 299 +A YL L E IV+GGGV K LL+ + ++ + GA + Sbjct: 207 ---VAGYLAQLCHTLFAFCAVECIVMGGGVMKT-PGLLERVHASAQSLDNRYLPGGARHQ 262 Query: 300 IAT--LGNDAGVIGGGWLVKQQEN 321 I + LGNDAG++G L N Sbjct: 263 IVSPKLGNDAGIVGALRLANASRN 286 Lambda K H 0.316 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 289 Length adjustment: 27 Effective length of query: 303 Effective length of database: 262 Effective search space: 79386 Effective search space used: 79386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory