Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_047092925.1 AAV99_RS06250 alpha-ketoacid dehydrogenase subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_001013305.1:WP_047092925.1 Length = 326 Score = 249 bits (636), Expect = 7e-71 Identities = 138/327 (42%), Positives = 206/327 (62%), Gaps = 9/327 (2%) Query: 1 MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE 60 M+ +SY DAI A+++ M+ D RVF++GEDVG GG + + GL E+FG +R+ DTPL+E Sbjct: 1 MTQISYRDAIRGAIRDAMQADPRVFLMGEDVGHYGGCYAVSKGLLEEFGPDRIRDTPLSE 60 Query: 61 SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG 120 SA G GIGAAM GMRPI E+ +F + A++QI++ AA IR+ S ++ PIV+R G Sbjct: 61 SAFTGAGIGAAMGGMRPIVEIMTCNFSLLALDQIMNNAATIRHMSGGQFNVPIVIRMATG 120 Query: 121 GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYR-- 178 GG HS S+E +A+ PG++++ P+T DA G+L A+ D DPVL FE+ Y Sbjct: 121 GGRQLGAQHSHSLEGWYAHIPGIRVLAPATVEDAAGMLAPALADPDPVLIFENALLYNEA 180 Query: 179 -LIKGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLR 237 + G V D I A ++REG DI++ITYG + L AAE L GIS+ V+DLR Sbjct: 181 AAMNGSVDID-----IDHAALRREGSDISLITYGGSLGKTLAAAEELYVSGISSDVLDLR 235 Query: 238 TVYPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDI 297 + PLD++AI+ +KT + ++V E + GSI +E+ A + E ++LDAPI R+ ++ Sbjct: 236 VLRPLDEDAILATVAKTRRAVIVDEGWRTGSISAEIMARLVERGFWNLDAPIARVCSEEV 295 Query: 298 PAMPYAPTMEKYFMVNPDKVEAAMREL 324 P +PYA +E+ + + + AA R + Sbjct: 296 P-IPYARHLEEAALPSISAIVAAARSV 321 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 326 Length adjustment: 28 Effective length of query: 299 Effective length of database: 298 Effective search space: 89102 Effective search space used: 89102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory