Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_047093751.1 AAV99_RS09610 pyruvate dehydrogenase complex E1 component subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_001013305.1:WP_047093751.1 Length = 461 Score = 276 bits (706), Expect = 7e-79 Identities = 141/317 (44%), Positives = 199/317 (62%), Gaps = 1/317 (0%) Query: 8 DAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAIAGVG 67 +A+ M EEM RD RVF++GE+V G +K T GL ++FG +RV+DTP+ E AG+G Sbjct: 142 EALRDGMAEEMRRDDRVFIMGEEVAEYQGAYKVTQGLLDEFGPKRVIDTPITEYGFAGIG 201 Query: 68 IGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGVHGAL 127 GAAM G+RPI E +F M A++ II+ AAK Y S CPIV R P G Sbjct: 202 TGAAMGGLRPIVEFMTFNFAMQAIDHIINSAAKTNYMSGGQMRCPIVFRGPNGAASRVGA 261 Query: 128 YHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGEVPAD 187 HSQ+ +A+ PGL ++ P DAKGL+KAA+R EDPV+F E++ Y D Sbjct: 262 QHSQNYGPWYASVPGLIVIAPYDAQDAKGLMKAAIRSEDPVVFLENELIYGQSFEVAQLD 321 Query: 188 DYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLDKEAI 247 D+VLPIGKA + REG D+T++TY + V +LQAA+ L + GI A V+DLRT+ PLDKEA+ Sbjct: 322 DHVLPIGKARIMREGSDVTIVTYSIAVGISLQAADELAEQGIEAEVIDLRTLRPLDKEAV 381 Query: 248 IEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYAPTME 307 + + +KT +V++ E SI SE+ AI E LDAP+ R+ D+P +PYA +E Sbjct: 382 LTSLAKTNRVVVAEEGWPTCSIASEIVAICMEEGFDHLDAPVLRVCNEDVP-LPYAANLE 440 Query: 308 KYFMVNPDKVEAAMREL 324 K +++ +V AA +++ Sbjct: 441 KLALIDKARVVAACKKV 457 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 461 Length adjustment: 30 Effective length of query: 297 Effective length of database: 431 Effective search space: 128007 Effective search space used: 128007 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory