Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_047094592.1 AAV99_RS13340 ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_001013305.1:WP_047094592.1 Length = 224 Score = 120 bits (302), Expect = 2e-32 Identities = 74/202 (36%), Positives = 109/202 (53%), Gaps = 7/202 (3%) Query: 18 VIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMIDGRDATEMPPAKRG- 76 V+ ++L IE GE V VGPSG GKST+L+ + LE G+I I G+DA+ + A+R Sbjct: 24 VLNGVNLTIEPGEIVALVGPSGSGKSTMLQAVGLLEGGFSGKIEIAGQDASTLDSAERTT 83 Query: 77 -----LAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKILNLTNYLDRRP 131 L V+Q + L P T ++NI P + + + R L L + +D RP Sbjct: 84 LRRDHLGFVYQFHHLLPDFTARENIVLPQLLLGVSRADAVVRAEQLLGALGLEHRMDHRP 143 Query: 132 GQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITELHQSLETTMIYVT 191 +LSGG++QRVA+ RA+ +P L DEP NLD + E EL + + + T Sbjct: 144 SKLSGGEQQRVAVARALANKPQLVLADEPTGNLDEKTSERVLGEFLELVRGQGSAALVAT 203 Query: 192 HDQVEAMTMADKIVVLNAGRIE 213 H++ A M D++V L+ GRIE Sbjct: 204 HNERLAARM-DRVVRLHEGRIE 224 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 224 Length adjustment: 25 Effective length of query: 307 Effective length of database: 199 Effective search space: 61093 Effective search space used: 61093 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory