Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_047093195.1 AAV99_RS05720 enoyl-CoA hydratase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_001013305.1:WP_047093195.1 Length = 260 Score = 122 bits (305), Expect = 1e-32 Identities = 84/254 (33%), Positives = 130/254 (51%), Gaps = 3/254 (1%) Query: 3 ELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFAAG 62 EL S + +TLN P N+L A+L LV + A D + + VITG R F G Sbjct: 7 ELQYSVVDNIARITLNAPDKLNSLAPAMLTGLVAAIAQAHEDGARCI-VITGTGRAFCTG 65 Query: 63 ADLNEM--AEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG 120 A L+ + DL A + + + P++ ++NG A GAG AL D+V+A Sbjct: 66 ARLDPSFAGDGDLGAVIEKYYDPAARAMADSDIPIVTSLNGIAAGAGLGFALSGDIVIAA 125 Query: 121 ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS 180 +A+ +G++P AG T L +SVG++ A +M+L E ++A+ A GL++ V Sbjct: 126 RSAQLLCAFARIGLVPDAGTTWMLAQSVGRAKALEMMLLAEEMSAEDAAAQGLIARVVDD 185 Query: 181 DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG 240 + ++A+K+A AL ++ +R + E L+ LA ER T+ T D EG Sbjct: 186 EALEAETAKVAAKLAAMPTKALGMIRKQVRATLEGDLENSLAAERGHQTIAGKTHDFREG 245 Query: 241 ISAFLQKRTPDFKG 254 + AF+QKR P FKG Sbjct: 246 VMAFIQKRLPSFKG 259 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 260 Length adjustment: 24 Effective length of query: 231 Effective length of database: 236 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory