Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_047092852.1 AAV99_RS05725 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_001013305.1:WP_047092852.1 Length = 259 Score = 283 bits (723), Expect = 3e-81 Identities = 155/259 (59%), Positives = 186/259 (71%), Gaps = 1/259 (0%) Query: 1 MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGS-EK 59 MA+E I ET+G V L+TLNRP ALNALN +++EL A F+ADD+ VVTGS EK Sbjct: 1 MAFETITSETKGAVTLITLNRPDALNALNTTVLNELQQAFAAFEADDSQHCAVVTGSGEK 60 Query: 60 AFAAGADIGMMSTYTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDI 119 AFAAGADI M D + D+ + E RKP IAAV GFALGGGCELAMM D Sbjct: 61 AFAAGADIKEMVDKQAADFFLEDFFSGWNEMTAKTRKPWIAAVNGFALGGGCELAMMADF 120 Query: 120 IFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSR 179 I A++ AKFGQPEIKLG+ PG GG+QRL RAV K+KAMDLCLT R MDAAEAERAGLV+R Sbjct: 121 IIASENAKFGQPEIKLGVAPGMGGSQRLTRAVGKSKAMDLCLTGRMMDAAEAERAGLVAR 180 Query: 180 VIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATED 239 ++P L+DEA++AA IA P A M+ KE V+ A+ETTLA+G+ ERRLF L AT+D Sbjct: 181 IVPHDQLMDEAMSAAEAIASMPPMAAMVNKELVDAAFETTLAQGLTHERRLFQILTATQD 240 Query: 240 QKEGMAAFVEKRKPVFKHR 258 + EGM+AFVEKR +K R Sbjct: 241 KSEGMSAFVEKRAANWKGR 259 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory