Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_047094365.1 AAV99_RS12275 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_001013305.1:WP_047094365.1 Length = 252 Score = 119 bits (298), Expect = 6e-32 Identities = 78/252 (30%), Positives = 123/252 (48%), Gaps = 11/252 (4%) Query: 11 EGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGK--GKAFCAGADIT 68 +G + + ++R DK NA N + E + + QA +DP +R ++I G FCAGADI Sbjct: 8 DGPVAHLLIDRLDKRNAFNMAMWEAMPGLLEQARADPAVRTLVIRSAQPGGVFCAGADIK 67 Query: 69 QFNQLTPAEAWKFSKKG--REIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEE 126 + AW + + + + L+ PT+A + G +GGG +A+ACD+R+A ++ Sbjct: 68 EMLLHKDDGAWLAANQAAINRVQHDLARLTLPTVAFVEGDCVGGGCGIAIACDLRVATDK 127 Query: 127 AQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLAN 186 A+ G+ LGI + LT ++G G+A M+ TG + +A++ GLV + Sbjct: 128 ARFGITPGKLGIVYPLHDVKLLTDLVGPGQAKRMLFTGGLLDAAEAQRIGLVEMIA---- 183 Query: 187 LEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVS 246 R L I SP S+ IK V R LD ++ + F D EG + Sbjct: 184 --DSPRGLLNDILSASPHSIREIKMFVRRVLDGQTGDDDQTLAI-FTDAFMRGDFAEGAA 240 Query: 247 AFLEKREPTFKG 258 AF KR+P F G Sbjct: 241 AFAGKRKPDFNG 252 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 252 Length adjustment: 24 Effective length of query: 235 Effective length of database: 228 Effective search space: 53580 Effective search space used: 53580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory