Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_047094562.1 AAV99_RS12760 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_001013305.1:WP_047094562.1 Length = 246 Score = 114 bits (285), Expect = 3e-30 Identities = 76/214 (35%), Positives = 113/214 (52%), Gaps = 22/214 (10%) Query: 14 GTTQ--ALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIGGRDVTTVE 71 G TQ AL ++ DI GE +V +GPSG GKST L + GL+ +SG + ++T Sbjct: 29 GETQVHALRGVDFDIRKGEVLVLLGPSGSGKSTFLNIVGGLDRSTSGTLYYAAENLTA-- 86 Query: 72 PADRDLA--------MVFQSYALYPHMTVRENMEFGMKV--NGFEPDLRKERIAEAARVL 121 +DRDL +FQ Y L P +T EN+ + N +P AEA + Sbjct: 87 KSDRDLTRFRRQRIGFIFQFYNLIPSLTAEENVRLVTDIASNPMDP-------AEALHHV 139 Query: 122 QLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHK 181 L + P QLSGG++QRVA+ RAI K P V L DEP LD+ +++ LE ++ Sbjct: 140 GLAERRHHFPAQLSGGEQQRVAVARAIAKRPGVLLCDEPTGALDSSTGIRVLEALEAANR 199 Query: 182 QLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQV 215 +L T++ +TH+ A MAD++ G+I ++ Sbjct: 200 ELDTTLLIITHNAGIA-AMADRVFHFLDGQIARI 232 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 246 Length adjustment: 26 Effective length of query: 312 Effective length of database: 220 Effective search space: 68640 Effective search space used: 68640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory