GapMind for catabolism of small carbon sources

 

Protein WP_048505667.1 in Chryseobacterium angstadtii KM

Annotation: NCBI__GCF_001045465.1:WP_048505667.1

Length: 575 amino acids

Source: GCF_001045465.1 in NCBI

Candidate for 11 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-galactose catabolism sglS hi Sodium transporter (characterized, see rationale) 54% 99% 577 Sodium/myo-inositol cotransporter 2; Na(+)/myo-inositol cotransporter 2; Sodium-dependent glucose cotransporter; Sodium/glucose cotransporter KST1; Sodium/myo-inositol transporter 2; SMIT2; Solute carrier family 5 member 11 33% 258.1
D-xylose catabolism Echvi_1871 hi SSS sodium solute transporter (characterized, see rationale) 49% 88% 456.8 Sodium/glucose cotransporter; Na(+)/glucose symporter 42% 419.1
D-cellobiose catabolism SSS-glucose hi Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized) 42% 94% 419.1 Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter) (Sodium/myo-inositol transporter 1) (SMIT1) (Solute carrier family 5 member 3) 31% 239.6
D-glucose catabolism SSS-glucose hi Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized) 42% 94% 419.1 Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter) (Sodium/myo-inositol transporter 1) (SMIT1) (Solute carrier family 5 member 3) 31% 239.6
lactose catabolism SSS-glucose hi Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized) 42% 94% 419.1 Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter) (Sodium/myo-inositol transporter 1) (SMIT1) (Solute carrier family 5 member 3) 31% 239.6
D-maltose catabolism SSS-glucose hi Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized) 42% 94% 419.1 Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter) (Sodium/myo-inositol transporter 1) (SMIT1) (Solute carrier family 5 member 3) 31% 239.6
sucrose catabolism SSS-glucose hi Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized) 42% 94% 419.1 Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter) (Sodium/myo-inositol transporter 1) (SMIT1) (Solute carrier family 5 member 3) 31% 239.6
trehalose catabolism SSS-glucose hi Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized) 42% 94% 419.1 Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter) (Sodium/myo-inositol transporter 1) (SMIT1) (Solute carrier family 5 member 3) 31% 239.6
L-arabinose catabolism Echvi_1880 lo SSS sodium solute transporter (characterized, see rationale) 39% 92% 417.9 Sodium/glucose cotransporter; Na(+)/glucose symporter 42% 419.1
myo-inositol catabolism SMIT1 lo Sodium/myo-inositol cotransporter 2; Na(+)/myo-inositol cotransporter 2; Sodium-dependent glucose cotransporter; Sodium/glucose cotransporter KST1; Sodium/myo-inositol transporter 2; SMIT2; Solute carrier family 5 member 11 (characterized) 33% 70% 258.1 Sodium/glucose cotransporter; Na(+)/glucose symporter 42% 419.1
D-galactose catabolism SGLT1 lo sodium/glucose cotransporter 1 (characterized) 31% 71% 245.4 Sodium/glucose cotransporter; Na(+)/glucose symporter 42% 419.1

Sequence Analysis Tools

View WP_048505667.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MGKLSTSDFVIFLIYFLVVTVYGLWIYKRKKSKTTGSKDYFLAEGSLTWWAIGASLIASN
ISAEQFIGMSGEGFFIGVAVAVYEWLAAIALIIIAVWFIPIYLKNKIYTMPQFLETRYNK
SVSLIMAIFWLFLYVIVNLTSILYLGAVAIDSLLGGGHLHIIMVVLLLMALFIGLGGMKV
IGYTDVIQVTVLIIGGFATVYMALQVVDQRINGAAVGNALTGLDTLLKEAPGHFKLILDK
PQVTTTTLSMPENLAAQKYIALPGLAMYFAGQWIVQLNYWGCNQYITQRALGADLKTARI
GILFAGFLKLFMPVIVVLPGIAAYVLYTKGHLSNFNGVKDSAYSAMLGLLPSGLKGLAVA
ALTAAIVASLAGKVNSISTIFTLDIYKKYLKTNTSEIQMVRTGRWAIIVAMLIALVFTWT
DILGIGGEGGFTFIQKYTGFISPGVFAMFILGMFWKITTGTAAIVGVILGFLLSIFFNSF
AVELFGKETWIYTAFTYEKLENGAVKTITEIPFLINMGWSFFITVAVMVLLSFFGPKVNP
KAFTIDKNMFKVDNRTLFLIVIIVLLLTAIYVRFW

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory