Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_059152495.1 V474_RS16345 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_001046635.1:WP_059152495.1 Length = 262 Score = 151 bits (381), Expect = 2e-41 Identities = 93/244 (38%), Positives = 135/244 (55%), Gaps = 4/244 (1%) Query: 12 GRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSE-KAFAAGADIGMM 70 G +GLVTLNRP+ NA+N A+ + A +++ +AD AI A+V+T +E F AGAD+ + Sbjct: 16 GHIGLVTLNRPEKRNAVNGAVARAIDAIVKQTEADPAIWAVVITSAEGPTFCAGADLAEV 75 Query: 71 STYTYMDVYKGDYITRNWETVRSIR-KPIIAAVAGFALGGGCELAMMCDIIFAADTAKFG 129 + D+ D + V ++R KP IAAV G ALGGG E+++ CD+ ADT G Sbjct: 76 AAGRGDDLSTPDGGFAGF--VEAVRVKPWIAAVKGSALGGGLEISLACDLRVVADTTVLG 133 Query: 130 QPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIPAASLVDE 189 PE+K G++ GAGG RLPR + +A A+++ T + A A GLV+RV+ ++D Sbjct: 134 LPEVKRGLIAGAGGIYRLPRQLPRAIALEMIATGEPIAAPRAAALGLVNRVVAEGEVIDA 193 Query: 190 AIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQKEGMAAFVE 249 A+ A I AV + A + + + R F L T+D EG AFVE Sbjct: 194 ALGLARAICANSPVAVRESLQVARSAADVPESASIQASREAFERLMLTDDFVEGPRAFVE 253 Query: 250 KRKP 253 KR P Sbjct: 254 KRPP 257 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 262 Length adjustment: 24 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory