Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_059151148.1 V474_RS08875 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_001046635.1:WP_059151148.1 Length = 251 Score = 145 bits (365), Expect = 1e-39 Identities = 101/251 (40%), Positives = 141/251 (56%), Gaps = 19/251 (7%) Query: 14 FRLDGRHALVTGGAQGIGFEIARGLAQAGARVTIA---------DLNPDVGEGAAR-ELD 63 F L+G+ ALVTG GIG IA LAQAGA V +A DL G A + D Sbjct: 5 FSLEGKSALVTGANTGIGQAIAVALAQAGADVAVAGRSEPAETLDLIAQTGRKAVNIKAD 64 Query: 64 -GTFERLNVTDADAVADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVF 122 + E + A+AVA L + +DVLVNNAGI+R ++DW AV+ NL +F Sbjct: 65 LSSIEPVQRVIAEAVAGLGK----LDVLVNNAGIIRRDDLLQFSEEDWDAVIDTNLKTLF 120 Query: 123 WCCREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRG 182 + + + M+ +G G IV+ AS+ P +Y A+K+ V +T+++A E A RG Sbjct: 121 FLSQAAAKGMVEQGSGKIVNIASLLTFQGGIRVP--SYAAAKSGVSGVTKAMANELAPRG 178 Query: 183 VRVNAVAPGYTATPLTRRGLETPEWRETW-LKETPLGRLAEPREIAPAVLYLASDAASFV 241 V+VNA+APGY +T T L+ E R L+ P GR P +IA A ++LAS A+++V Sbjct: 179 VQVNAIAPGYISTNNT-AALQGDETRNRQILERIPTGRWGNPDDIAGAAVFLASPASNYV 237 Query: 242 TGHTLVVDGGY 252 TGH L VDGG+ Sbjct: 238 TGHVLAVDGGW 248 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory