Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_059153062.1 V474_RS19410 glucose 1-dehydrogenase
Query= reanno::Phaeo:GFF1301 (257 letters) >NCBI__GCF_001046635.1:WP_059153062.1 Length = 260 Score = 215 bits (548), Expect = 6e-61 Identities = 126/254 (49%), Positives = 157/254 (61%), Gaps = 4/254 (1%) Query: 4 LSGKRALITGAARGIGAAFAEAYANEGARVVIADIDTARAEATAAQI---GAAAIAVELD 60 L+GK AL+TGAA GI A AYA +GAR+V AD + AEATAA I G A A+ D Sbjct: 3 LTGKIALVTGAASGISREIAHAYAEQGARIVCADRNGEAAEATAAAIRSAGGQAEALRCD 62 Query: 61 VTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGTLFMMQ 120 +T QA D A+S GGLDIL+N A + A PL++VT +++Q FDINV+G FM+Q Sbjct: 63 ITSQADRDAAVSMATSFDGGLDILVNGAGILQAQPLLDVTPDSFQSVFDINVTGLFFMLQ 122 Query: 121 AAAQQMITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHGINVNA 180 A+A+ MI G G+IIN+AS AGR+G Y A+KAAVIS+TQSAG L H I VNA Sbjct: 123 ASARAMIAAGRSGRIINLASIAGRQGIGTSVQYSASKAAVISITQSAGQALAPHNICVNA 182 Query: 181 IAPGVVDGEHWDGVDAF-FAKYEGKAPGQKKAEVAQSVPYGRMGTAADLTGMAVFLASED 239 IAPG V W + A A A + + Q V GR+ D+ G A+FLA E Sbjct: 183 IAPGFVQTAMWREIQAMAVAGSAAIAAEEFNDGIVQQVAKGRLADPGDMVGAALFLAGEG 242 Query: 240 ADYVVAQTYNVDGG 253 A+YVV QT NVDGG Sbjct: 243 AEYVVGQTINVDGG 256 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 260 Length adjustment: 24 Effective length of query: 233 Effective length of database: 236 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory