Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_059152117.1 V474_RS11795 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::Q00384 (208 letters) >NCBI__GCF_001046635.1:WP_059152117.1 Length = 210 Score = 239 bits (611), Expect = 2e-68 Identities = 121/201 (60%), Positives = 151/201 (75%) Query: 4 IDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIKIMKEVPGAV 63 ++ VMRLAPV+PVLVIEDI A PIAEALVAGGL LEVTLRT CA+EAI+IMK+VPGA+ Sbjct: 10 VEKVMRLAPVIPVLVIEDIEHALPIAEALVAGGLPALEVTLRTECAIEAIRIMKQVPGAM 69 Query: 64 VGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLG 123 VGAGTVL L ++ +AG EF VSPGLT LG+ A+ LPG ANA+DVML L++G Sbjct: 70 VGAGTVLTPDDLSRSLDAGAEFIVSPGLTPTLGQAALDAGVPFLPGTANASDVMLALEMG 129 Query: 124 LDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPTSAPKYLENPSILCVGGSWVVP 183 +R KFFPA GG PALK++++ +FCPTGG+TP +A ++L ++LCVGGSW+VP Sbjct: 130 FNRLKFFPAMAAGGPPALKAISAPLLAAKFCPTGGVTPENAAEWLALDAVLCVGGSWMVP 189 Query: 184 AGKPDVAKITALAKEASAFKR 204 GKPD AKI A A+ A+ R Sbjct: 190 KGKPDAAKIEAAARVAAGLAR 210 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 208 Length of database: 210 Length adjustment: 21 Effective length of query: 187 Effective length of database: 189 Effective search space: 35343 Effective search space used: 35343 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory