Align serine racemase (EC 5.1.1.18) (characterized)
to candidate WP_066603399.1 V473_RS10210 threonine ammonia-lyase
Query= BRENDA::O59791 (323 letters) >NCBI__GCF_001046645.1:WP_066603399.1 Length = 415 Score = 219 bits (557), Expect = 1e-61 Identities = 121/318 (38%), Positives = 174/318 (54%), Gaps = 3/318 (0%) Query: 5 LVLP-TYDDVASASERIKKFANKTPVLTSSTVNKEFVAEVFFKCENFQKMGAFKFRGALN 63 L LP T DD+ +A RI KTP L S T++ V+ K EN Q A+K RGALN Sbjct: 11 LPLPITVDDILAARTRIAGSIVKTPTLISQTLSNMLGCNVYLKFENLQFTAAYKERGALN 70 Query: 64 ALSQLNEAQRKAGVLTFSSGNHAQAIALSAKILGIPAKIIMPLDAPEAKVAATKGYGGQV 123 L QL++A + GV+ S+GNHAQ +A K LG+P I+MP P K+ T+G+G V Sbjct: 71 RLIQLDDAAKAKGVIAASAGNHAQGLAYHGKRLGVPVTIVMPTTTPTVKITQTQGHGATV 130 Query: 124 IMYDRYKDDREKMAKEISEREGLTIIPPYDHPHVLAGQGTAAKELFEEVGPLDALFVCLG 183 + Y DD A+ + E +GLT + P+D P ++AGQGT A E+ E+ +D L + +G Sbjct: 131 VQYGEKFDDAYAHARLMEEEQGLTFVHPFDEPDIMAGQGTVALEMLEDAPEIDTLIIPIG 190 Query: 184 GGGLLSGSALAARHFAPNCEVYGVEPEAGNDGQQSFRKGSIVHIDTPKTIADGAQTQHLG 243 GGGL SG AAR P+ ++YGV+ E F KG+ + D T+A+G + G Sbjct: 191 GGGLFSGMGTAARAMKPDIQLYGVQAEL-YPSMYDFIKGADLACD-GDTLAEGIAVKQPG 248 Query: 244 NYTFSIIKEKVDDILTVSDEELIDCLKFYAARMKIVVEPTGCLSFAAARAMKEKLKNKRI 303 T ++ DD+L VS+ L + L K VVE G AA +EK + + Sbjct: 249 ELTRRFVERLADDVLLVSERRLEEALSLLLQIEKTVVEGAGAAGLAALLTYREKFAGRNV 308 Query: 304 GIIISGGNVDIERYAHFL 321 G++++GGN+D A+ L Sbjct: 309 GLVLTGGNIDTRLLANVL 326 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 415 Length adjustment: 30 Effective length of query: 293 Effective length of database: 385 Effective search space: 112805 Effective search space used: 112805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory