Align acetyl-CoA:acetoacetate CoA transferase, B subunit (EC 2.8.3.8) (characterized)
to candidate WP_066602519.1 V473_RS08315 3-oxoacid CoA-transferase subunit B
Query= reanno::psRCH2:GFF1044 (209 letters) >NCBI__GCF_001046645.1:WP_066602519.1 Length = 215 Score = 299 bits (766), Expect = 2e-86 Identities = 149/209 (71%), Positives = 175/209 (83%), Gaps = 2/209 (0%) Query: 1 MAWTREQMAQRAAQELQDGFYVNLGIGLPTLVANYIPEGMDVWLQSENGLLGIGPFPTEE 60 M WTR+QMA RAAQEL+DG+YVNLGIG+PTLVAN++P+G++V LQSENG+LGIGPFP + Sbjct: 1 MGWTRDQMAARAAQELRDGYYVNLGIGIPTLVANHVPDGVNVTLQSENGMLGIGPFPYAD 60 Query: 61 EIDPDLINAGKQTVTALPGSSFFDNAQSFAMIRGGHINLAILGAMQVSEKGDLANWMIPG 120 E DPDLINAGKQT+TALP SSFF +A SFAMIRGGHI++A+LGAM+V+ GDLANW IPG Sbjct: 61 EADPDLINAGKQTITALPTSSFFSSADSFAMIRGGHIDMAVLGAMEVAANGDLANWTIPG 120 Query: 121 KMVKGMGGAMDLVAGVKRVVVLMEHTAKGGAHKILPACDLPLTGLGVVDRIITDLGVL-- 178 KMVKGMGGAMDLVAGVKRVVV+M+H +K G+ KILP C LPLTG VVD IITDL V+ Sbjct: 121 KMVKGMGGAMDLVAGVKRVVVVMDHVSKNGSPKILPTCSLPLTGKAVVDLIITDLAVIAV 180 Query: 179 DVTEQGLKLVELAEGVSFDELQEATGSPI 207 D GL LVELA GVS E+ TG+P+ Sbjct: 181 DRARGGLTLVELAPGVSKAEVIAKTGAPL 209 Lambda K H 0.318 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 209 Length of database: 215 Length adjustment: 21 Effective length of query: 188 Effective length of database: 194 Effective search space: 36472 Effective search space used: 36472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory