Align L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease (characterized)
to candidate WP_066605879.1 V473_RS13390 sugar MFS transporter
Query= SwissProt::P11551 (438 letters) >NCBI__GCF_001046645.1:WP_066605879.1 Length = 435 Score = 213 bits (543), Expect = 7e-60 Identities = 143/414 (34%), Positives = 226/414 (54%), Gaps = 22/414 (5%) Query: 29 ALLCSLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKL 88 ALL SLFF+W +N+ LLP + F L+ Q LI+S ++ YF+ IP+ L++++ Sbjct: 26 ALLASLFFMWGFITVINNTLLPHLRSVFELSYTQTTLIESVWFIAYFVASIPSAKLIERV 85 Query: 89 SYKAGIITGLFLYALGAALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPE 148 Y+ ++ GL + A GA AA I +Y + LV LF+IA+G+ L+ AANP+V ++G Sbjct: 86 GYQKSLVIGLLIMAAGALGMTVAASIPSYGVTLVMLFVIASGITLLQVAANPYVAIVGKP 145 Query: 149 SSGHFRLNLAQTFNSFGAIIAVVFGQSLILSNVPHQSQDVLDKMSPEQLSAYKHSLVLSV 208 + RLNL Q NS G ++A +FG LIL + ++ + A S++L Sbjct: 146 ETASSRLNLVQAMNSAGTMLAPLFGAYLILGRSKGGTAQGDVVLTQAERLADAQSVIL-- 203 Query: 209 QTPYMIIVAIVLLVALLIMLTKFP------ALQSDNHSDAKQGSFSASLSRLARIRHWRW 262 PY +IVA+VL V L I++ +FP A Q N + K+ S L R+ + Sbjct: 204 --PY-VIVAVVLAV-LAIVIARFPLPAMGNATQRHNKEERKKHS-------LWNHRNLVF 252 Query: 263 AVLAQFCYVGAQTACWSYLIRYAVE-EIPGMTAGFAANYLTGTMVCFFIGRFTGTWLISR 321 + A F Y+ A+ + + + + +I +T A YLT IGRF G+ ++ + Sbjct: 253 GIPAIFIYLIAEIGVANLFVNFVSQPDIANLTHEQAGRYLTFLWGGMMIGRFAGSAIMQK 312 Query: 322 FAPHKVLAAYALIAMALCLISAFAGGHVGLIALTLCSAFMSIQYPTIFSLGIKNLGQDTK 381 F VLAA+++ A + L++ F G V + +L L F SI +PTIF+LGIK LG T+ Sbjct: 313 FDAGHVLAAFSIGAFIVMLVTVFTTGPVAMWSLILVGLFHSIMFPTIFTLGIKGLGPLTE 372 Query: 382 YGSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELIPALCFAVIFIFARFRSQT 435 GS ++M I GG +V V G+++D G + T+ L+ A+C I +A + S+T Sbjct: 373 EGSGLLIMAIAGGALVV-VQGWLADHYG-LQTSFLLTAICELYILFYALWGSKT 424 Lambda K H 0.329 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 435 Length adjustment: 32 Effective length of query: 406 Effective length of database: 403 Effective search space: 163618 Effective search space used: 163618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory