Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate WP_066603923.1 V473_RS11155 electron transfer flavoprotein subunit alpha
Query= BRENDA::Q18AQ5 (336 letters) >NCBI__GCF_001046645.1:WP_066603923.1 Length = 310 Score = 170 bits (431), Expect = 4e-47 Identities = 121/330 (36%), Positives = 183/330 (55%), Gaps = 26/330 (7%) Query: 1 MGNVLVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHY-GAD 59 M LV +E ++ +L + A ++ + V L+ G V+G+ A G Sbjct: 1 MSKTLVWVEHEGGAVKDATLSAITAAAKLGE-----VHLLVAGQGVDGVAAAAAKIAGVG 55 Query: 60 EVIVVDDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTAD 119 +V V DD A A E E + D V ATS G+++APRV+A + +D Sbjct: 56 KVHVADDAAFAHALAENVAPLIVELMGHHDAFVA--PATSNGKNIAPRVAALLDVMQISD 113 Query: 120 CTGLAVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDE---TKEAV 176 + +EDT TRP + GN +AT+ KD + ++ TVR +K E D T EAV Sbjct: 114 ILSVE-SEDT----FTRPIYAGNAIATVKSKDAK-KVITVRGTAFEKAERDGGSGTVEAV 167 Query: 177 INRFKVEFNDADKLVQVVQVIKEAK-KQVKIEDAKILVSAGRGM-GGKENLDILYELAEI 234 + DK + + AK ++ ++ AKI+VS GR + G ++++ LA+ Sbjct: 168 AST-------GDKGLSSFVGAEIAKLERPELTSAKIIVSGGRALKDGPTFEEVIFPLADK 220 Query: 235 IGGEVSGSRATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAIN 294 +G V SRA +DAG++ QVGQTGK V P++Y+A GISGAIQH+AGM+D++ I+AIN Sbjct: 221 LGAAVGASRAAVDAGYVPNDYQVGQTGKIVAPEVYVAVGISGAIQHLAGMKDSKTIIAIN 280 Query: 295 KNPEAPIFKYADVGIVGDVHKVLPELISQL 324 K+ +APIF+ AD+G+VGD+ KV+PEL +L Sbjct: 281 KDEDAPIFQVADIGLVGDLFKVVPELTGKL 310 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 310 Length adjustment: 28 Effective length of query: 308 Effective length of database: 282 Effective search space: 86856 Effective search space used: 86856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory