Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate WP_066601311.1 V473_RS05465 CoA transferase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >NCBI__GCF_001046645.1:WP_066601311.1 Length = 395 Score = 240 bits (612), Expect = 6e-68 Identities = 153/406 (37%), Positives = 219/406 (53%), Gaps = 21/406 (5%) Query: 1 MGALSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENT 60 +GAL +RVLD + V+AGP+A ++LADLGA+VIKVE GD RA P + Sbjct: 10 VGALDGVRVLDFTSVMAGPFATRMLADLGAEVIKVESL-EGDQVRARPP--------KRD 60 Query: 61 TEAAYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKA 120 +AY+ + N KQS+ + PE L+++L A DIL+ENF+ G +A +GLD+ +L+ Sbjct: 61 GFSAYFGNLNAGKQSIACNLKSPEIIALIKDLIATCDILVENFRPGVMARFGLDFAALRE 120 Query: 121 INPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDI 180 NP+LIYCSI+G+GQTGP A Y +I G + R + D P GV + D+ Sbjct: 121 ANPRLIYCSISGYGQTGPKALSPAYAPVIHAASGFDMVNLRYQ-DGADRPATSGVFIADV 179 Query: 181 LTGLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHP 240 L G ++ AI AAL R+ G GQHID+++L+ V L + G+A + L Sbjct: 180 LGGTHAFGAIQAALYQREKTGAGQHIDLSMLEAMVGMLVFETQEAQFPGDARRPL----- 234 Query: 241 NIVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLI 300 Y T DG ++ + F + + G P+W DDPRF TN R AN A L+ L Sbjct: 235 ----YTPLKTNDGFIMVAPTSPRNFEQLTDAVGHPEWRDDPRFLTNADRNANWATLLALT 290 Query: 301 RQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVAS 360 T ++ E L + GVPCG ++ ++ DPQ+ +RG E+ AG Sbjct: 291 ETWTRERSAEEAEAILSRHGVPCGRYREIDELLDDPQLASRGAFAEISD-GAGSFKVPNP 349 Query: 361 PIRLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMAFREAGVL 406 P R+S + VE RN LGE ++L + LG+DE+AV A R G L Sbjct: 350 PFRMSGSRVEARNHVARLGEEGADILTK-LGVDESAVAALRARGDL 394 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 395 Length adjustment: 31 Effective length of query: 375 Effective length of database: 364 Effective search space: 136500 Effective search space used: 136500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory