Align BadK (characterized)
to candidate WP_066601421.1 V473_RS05770 2,3-dehydroadipyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_001046645.1:WP_066601421.1 Length = 260 Score = 177 bits (450), Expect = 1e-49 Identities = 106/243 (43%), Positives = 144/243 (59%), Gaps = 5/243 (2%) Query: 16 IITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIASMAAWSY 75 ++ LNRP+ NAL L+ + AL A D I A+VI G R FAAGADIA +A+ Sbjct: 19 LLRLNRPEKRNALATDLLGRIADALDAAAGDPAIRAVVITGADRFFAAGADIAELAS--- 75 Query: 76 SDVYGSNFITRN--WETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSAKFALPEI 133 D G+ R W IR KP++AAV G + G G EL + CD+V+AG SAKF PE Sbjct: 76 RDTGGALADPRPAIWTRIRGFAKPLIAAVEGWSLGAGNELVMCCDLVVAGESAKFGQPET 135 Query: 134 KLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRLRDETVAL 193 LG++PGAGGT LPR +G+++AM M L PL+A EA + GL++++V+D + L Sbjct: 136 NLGIIPGAGGTAILPRLVGRSRAMRMVLLGDPLSAAEALQAGLIAQMVEDGQALSVATEL 195 Query: 194 ATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQAFLEKRAP 253 AT IAA + A+ K + FE+ + +L ER+ A F +AD REG AF EKR P Sbjct: 196 ATRIAARAPLAMQQGKAMVRATFETHQSAHLLLERQAFSALFGTADKREGTSAFFEKRDP 255 Query: 254 CFS 256 +S Sbjct: 256 QWS 258 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory