Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_066607980.1 V473_RS17445 D-glycerate dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >NCBI__GCF_001046645.1:WP_066607980.1 Length = 319 Score = 141 bits (356), Expect = 2e-38 Identities = 102/307 (33%), Positives = 150/307 (48%), Gaps = 26/307 (8%) Query: 25 FELHFQQAHLQADTAVLAQGF---EVVCAFVNDDLSRPVLERLAAGG-TRLVALRSAGYN 80 + + F + D A LAQ + +C V D ++R VL L G R+VA AGY+ Sbjct: 25 YHVTFNEDDRPMDAAALAQAMRDHDALCPTVTDRVTREVL--LTQGRRARIVANYGAGYD 82 Query: 81 HVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTREGDFS----LHG 136 H+DL AA GL V + P A A+ A+ L+L RR R GD+S H Sbjct: 83 HIDLDAARGAGLAVTNTPDVLTDATADIAMTLMLMAMRRAGEGERELRAGDWSGWRPTH- 141 Query: 137 LTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNPRIQALGGRYLALDALLA 196 + G L GK + ++G G+I A+ FG + + P + + + L AL Sbjct: 142 MIGQSLDGKLLALVGFGRIARAVAKRAQAFGMRVAYHSRRPAADMP-INAYFADLGALAQ 200 Query: 197 ESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAALIEALKSGQLGYLG 256 ++D++SLH P +TRH++DA LA M +L+NTGRG+LV+ AAL +AL + ++ G Sbjct: 201 QADVLSLHAPGGVETRHMVDAALLARMPAHGVLVNTGRGSLVDEAALAQALAARRIAAAG 260 Query: 257 LDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREALAAIADTTLDNIA 316 LDVYE E + L++ PNVV+ H T EA A+ DN+ Sbjct: 261 LDVYEGEPQVH--------------PSLIALPNVVLLPHLGSATIEARTAMGMKVADNLD 306 Query: 317 AWQDGTP 323 + G P Sbjct: 307 RFFAGEP 313 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 319 Length adjustment: 28 Effective length of query: 301 Effective length of database: 291 Effective search space: 87591 Effective search space used: 87591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory