Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate WP_066603923.1 V473_RS11155 electron transfer flavoprotein subunit alpha
Query= BRENDA::H6LBB1 (418 letters) >NCBI__GCF_001046645.1:WP_066603923.1 Length = 310 Score = 141 bits (356), Expect = 2e-38 Identities = 103/315 (32%), Positives = 168/315 (53%), Gaps = 16/315 (5%) Query: 76 VYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLMGTNITEKADELLKY-GVDKVFVY 134 V+V+H G + T I A +L V + L+ G + A K GV KV V Sbjct: 6 VWVEHEGGAVKDATLSAITAAAKLGEV-----HLLVAGQGVDGVAAAAAKIAGVGKVHVA 60 Query: 135 DKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAPRVAARYRTGLTADCTILE 194 D H + E A ++ + + + + AT+ G+++APRVAA +D +E Sbjct: 61 DDAAFAHALAENVAPLIVELMGH--HDAFVAPATSNGKNIAPRVAALLDVMQISDILSVE 118 Query: 195 MKENTDLVQIRPAFGGNIMAQIVTENTRPQFCTVRYKVFTAPERVNEPWGDVEMMDIEKA 254 ++ RP + GN +A + +++ + + TVR F ER G VE + Sbjct: 119 SEDTFT----RPIYAGNAIATVKSKDAK-KVITVRGTAFEKAERDGGS-GTVEAVASTGD 172 Query: 255 KLVSAIEVMEVIKKEKGIDLSEAETIVAVGRGVKCEKDLD-MIHEFAEKIGATVACTRPG 313 K +S+ E+ K E+ +L+ A+ IV+ GR +K + +I A+K+GA V +R Sbjct: 173 KGLSSFVGAEIAKLERP-ELTSAKIIVSGGRALKDGPTFEEVIFPLADKLGAAVGASRAA 231 Query: 314 IEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQNSEYIIAINSDPKAPIFNIA 373 ++AG+ Q+G +G+ V P++ +A+GISGA+Q AGM++S+ IIAIN D APIF +A Sbjct: 232 VDAGYVPNDYQVGQTGKIVAPEVYVAVGISGAIQHLAGMKDSKTIIAINKDEDAPIFQVA 291 Query: 374 HCGMVGDLYEILPEL 388 G+VGDL++++PEL Sbjct: 292 DIGLVGDLFKVVPEL 306 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 310 Length adjustment: 29 Effective length of query: 389 Effective length of database: 281 Effective search space: 109309 Effective search space used: 109309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory