Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_066605148.1 V473_RS05785 3-oxoacid CoA-transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_001046645.1:WP_066605148.1 Length = 216 Score = 289 bits (740), Expect = 2e-83 Identities = 141/208 (67%), Positives = 173/208 (83%), Gaps = 1/208 (0%) Query: 5 KKLSRTEMAQRVAADIQEGAYVNLGIGAPTLVANYLG-DKEVFLHSENGLLGMGPSPAPG 63 ++++R EMA RVA DI EGAYVNLGIG PT+VAN+L ++++FL SENGLLGMGP+PA Sbjct: 2 QRMNREEMAARVARDIPEGAYVNLGIGLPTMVANFLPQERDIFLQSENGLLGMGPAPAEE 61 Query: 64 EEDDDLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGA 123 + D +LINAGKQ VTLL GG+FFHH DSFSMMRGGH+DI VLGAFQVSV GDLANWHTGA Sbjct: 62 DVDWELINAGKQPVTLLAGGSFFHHGDSFSMMRGGHIDICVLGAFQVSVNGDLANWHTGA 121 Query: 124 EGSIPAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLE 183 +IPAVGGAMDLA GA+QVFVMMD +TK G+SKLV +C+YPLTG++CVSR+YTD+AV + Sbjct: 122 PDAIPAVGGAMDLAVGAKQVFVMMDLMTKRGQSKLVAQCSYPLTGLSCVSRVYTDVAVFD 181 Query: 184 VTPEGLKVVEICADIDFDELQKLSGVPL 211 V P G VVE+ + D+L+ ++GV L Sbjct: 182 VGPAGAHVVEMVPGMTIDQLRDMTGVDL 209 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 216 Length adjustment: 22 Effective length of query: 191 Effective length of database: 194 Effective search space: 37054 Effective search space used: 37054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory