Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate WP_066608038.1 V473_RS17555 acyl-CoA dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >NCBI__GCF_001046645.1:WP_066608038.1 Length = 374 Score = 421 bits (1082), Expect = e-122 Identities = 217/372 (58%), Positives = 279/372 (75%) Query: 4 TDEQLQISDAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTG 63 T+ Q I D R FAQE ++P +A ++ E +P E EMA LG +GM PE +GG +T Sbjct: 3 TEIQAAIRDTVRDFAQETIRPHSARFESEGGYPPELFREMAGLGLWGMTAPEAFGGAETD 62 Query: 64 YLAYAMALEEIAAGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAFAL 123 ++YA+AL EIAA DGA STI+S+ NS+ +LK G+D QK RFL L G M+GAFAL Sbjct: 63 AVSYALALMEIAAADGALSTIVSIQNSILVSGLLKDGSDAQKARFLPDLIGGRMIGAFAL 122 Query: 124 TEPQAGSDASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFI 183 TE AGSDAS+++TRA + + G KQFITSG+ AG+V++ AVTDP AGK+G+S F+ Sbjct: 123 TEADAGSDASAVRTRATKVDGGWRITGAKQFITSGKIAGLVMIVAVTDPDAGKKGLSVFL 182 Query: 184 VPTDSPGYKVARVEDKLGQHASDTCQILFEDVQVPVANRLGEEGEGYKIALANLEGGRVG 243 VPTD PGY V +VE K+GQ ASDTC + F+D+ V +G+ G+GY+IALANLE GR+G Sbjct: 183 VPTDRPGYGVDKVEHKMGQGASDTCALRFDDMFVEHDLLIGQPGQGYRIALANLETGRIG 242 Query: 244 IASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAAL 303 IA+Q VGMA+AA + A YA++R+SFGK I+EHQAV FRLAD+AT++ ARQ+V +AA Sbjct: 243 IAAQCVGMAQAALDIAVAYAKDRKSFGKAIMEHQAVGFRLADLATRLEAARQLVLHAART 302 Query: 304 RDSGKPALVEASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIYEGT 363 +D+G P L EASMAKLFASE AE + S ALQTLGGYGYL ++ + +IYRDVRVCQIYEGT Sbjct: 303 KDAGLPCLAEASMAKLFASEAAEAIVSGALQTLGGYGYLEEYGVAKIYRDVRVCQIYEGT 362 Query: 364 SDIQRMVISRNL 375 SDIQRMVI+R+L Sbjct: 363 SDIQRMVIARSL 374 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 374 Length adjustment: 30 Effective length of query: 345 Effective length of database: 344 Effective search space: 118680 Effective search space used: 118680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory