Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate WP_066608318.1 V473_RS18095 acyl-CoA dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >NCBI__GCF_001046645.1:WP_066608318.1 Length = 380 Score = 237 bits (605), Expect = 3e-67 Identities = 133/372 (35%), Positives = 212/372 (56%), Gaps = 4/372 (1%) Query: 5 DEQLQISDAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTGY 64 D+ D RQ + L P +++ E ++ + G V E+ GG + Sbjct: 12 DDHAMFRDTVRQVFAKELIPNLDKFEDEGIVSRDFWRACGDAGMLCPTVKEEHGGLGLDF 71 Query: 65 LAYAMALEEIA-AGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAFAL 123 + EE+A AG A T+ N + I +G+ +Q E++L + SG + A A+ Sbjct: 72 GFNVVIAEELAYAGSSAGITLQ---NDITAEYIEVYGSPEQHEKYLPKMVSGECITAIAM 128 Query: 124 TEPQAGSDASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFI 183 TEP GSD ++T A+ +G+HYV+NG K +IT+GQNA VVIV A T P G +G+S + Sbjct: 129 TEPGTGSDLQGIRTTAKKDGNHYVINGSKTYITNGQNADVVIVAAKTAPELGAKGVSLIL 188 Query: 184 VPTDSPGYKVARVEDKLGQHASDTCQILFEDVQVPVANRLGEEGEGYKIALANLEGGRVG 243 V D G+K R DK+GQH++DT ++ FEDV+VP+ N LG+EG+G+ ++ L R+ Sbjct: 189 VDADVAGFKRGRNLDKIGQHSADTSELFFEDVRVPITNCLGQEGQGFIYLMSQLPQERLS 248 Query: 244 IASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAAL 303 IA + A+ AF+ A + +ER++FG+ + + Q F LADM +Q+ V + +A Sbjct: 249 IAVSAQAAAQRAFDEAVSFTKERQAFGQAVFQFQNTKFTLADMKSQLQVGWAHLDWAIKR 308 Query: 304 RDSGKPALVEASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIYEGT 363 G EAS AK + ++M +V ALQ GG GY++++ + R++RD RV +I+ GT Sbjct: 309 HLVGALTTAEASAAKQWHTDMQGRVIDMALQLHGGAGYMNEYMVARLWRDARVTRIFGGT 368 Query: 364 SDIQRMVISRNL 375 ++I + V+SR+L Sbjct: 369 NEIMKEVVSRSL 380 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 380 Length adjustment: 30 Effective length of query: 345 Effective length of database: 350 Effective search space: 120750 Effective search space used: 120750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory