Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_052595448.1 VV02_RS23015 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_001190945.1:WP_052595448.1 Length = 314 Score = 97.1 bits (240), Expect = 4e-25 Identities = 63/206 (30%), Positives = 110/206 (53%), Gaps = 9/206 (4%) Query: 12 LLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVLF- 70 +L WVTI+++I + + ++ G +L MR++ +LR+LS YI R TPL + ++F Sbjct: 64 ILSGVWVTIQISILATVVGLVLGVLLAIMRLAHNPVLRSLSWFYIWFFRGTPLIVQLIFW 123 Query: 71 --CSFGLYQNLGLTLAGRESSTFLVDNN----FRLAVLGFILYTSTFVAESLRSGINTVH 124 +F L+ +L L + E F N F A+LG L + + AE++R+GI V Sbjct: 124 YNLAF-LFPHLILKIPFTEVGVFWDTNRVMTGFTAAMLGLGLNMAAYFAETVRAGIQAVD 182 Query: 125 FGQAEAARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASLLM 184 GQ +AA ++G+ R I+ PQA+R I P GN I++ K T++ V+ G + Sbjct: 183 EGQTDAAYAMGMTPAQRMRYIVLPQALRIIIPPTGNEFISMLKTTSLVYVV-AGNDLMTN 241 Query: 185 KATIENHANMLFVVFAIFAVGFMILT 210 + I N++ + + + +M++T Sbjct: 242 ASQIYKTNNLIMELLIVASAWYMLMT 267 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 314 Length adjustment: 25 Effective length of query: 203 Effective length of database: 289 Effective search space: 58667 Effective search space used: 58667 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory