Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_083450393.1 VV02_RS26180 ABC transporter substrate-binding protein/permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_001190945.1:WP_083450393.1 Length = 492 Score = 92.0 bits (227), Expect = 2e-23 Identities = 64/179 (35%), Positives = 89/179 (49%), Gaps = 16/179 (8%) Query: 5 WADLGPSLLPAFWVTIKLTI-YSAIG---AMIFGTILTTMRVSPVKILRTLSTAYINTVR 60 W + + P T+K TI +AIG ++ + R+S I + YI+ +R Sbjct: 276 WELIKDNAWPMLKATLKFTIPLTAIGFCVGLVIALFVALARMSSNPIASGAARVYISIIR 335 Query: 61 NTPLTLVVLFCSFGLYQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGI 120 TPL LV LF F LG + N F A + F L + AE +RS I Sbjct: 336 GTPL-LVQLFIIFFALPELGFKI-----------NAFPAAAIAFSLNVGGYAAEIIRSAI 383 Query: 121 NTVHFGQAEAARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGE 179 ++ GQ EA ++G+ + T R II PQA R A+ PL NTLI+L K+T +ASVI V E Sbjct: 384 QSLPKGQWEAGSTVGMNYATTLRRIILPQAARTAVPPLSNTLISLVKDTALASVITVPE 442 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 492 Length adjustment: 28 Effective length of query: 200 Effective length of database: 464 Effective search space: 92800 Effective search space used: 92800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory