Align ABC transporter for D-Sorbitol, permease component 2 (characterized)
to candidate WP_052594234.1 VV02_RS19465 sugar ABC transporter permease
Query= reanno::Phaeo:GFF1304 (288 letters) >NCBI__GCF_001190945.1:WP_052594234.1 Length = 310 Score = 122 bits (305), Expect = 1e-32 Identities = 90/293 (30%), Positives = 153/293 (52%), Gaps = 21/293 (7%) Query: 5 HSRSAAR-IMMAPAVILLLGWMLVPLTMTLYFSFKKYLPLRG---GDLGWVGFDNYARFL 60 H R+AAR I + PAV++L ++ P+ ++Y +F LRG + +VG DN+ Sbjct: 22 HRRTAARGIPLLPAVLVLGAFLAGPVLYSIYLAFTNRA-LRGEGASETSFVGLDNFRTAF 80 Query: 61 SSSAFWPSVQATLV--IVGGVLAITVILGVFLALLLNQPMWGQGIVRILVIAPFFVMPTV 118 +S FW +V TLV +V G++ V LG+ LALLL + G++ ++ +++P V Sbjct: 81 DTSEFWNAVGLTLVFTVVSGIIGQNV-LGMALALLLRRSATWVGVLTGTIVVGAWIVPEV 139 Query: 119 SA-LVWKNMFMD--PVNGL--FAHLWKAFGAEPVSWLSEASLQSIILIVSWQWLPFATLI 173 A +W D +NG+ F HL WL + + ++ W+ FA L Sbjct: 140 VAGYLWYTFLSDGGSLNGILGFLHLPNQ------DWLIASPIIAVSFANIWRGTAFAMLT 193 Query: 174 LLTAIQSLDSEQLEAAEMDGAPPVARFGYITLPHLSRAITVVVLIQTIFLLSIFAEIFVT 233 A+ + E E+A++DGA PV RF ITLP L R+I +++ T+ LS+F I+V Sbjct: 194 YSAALSQVSPELDESAQIDGAGPVRRFWSITLPLLRRSIMTCLMLTTLQTLSVFGLIYVM 253 Query: 234 TQGSFG--TKTLTYLIYQRVLESQNVGLGSAGGVYAIILANIVAIFLMRIVGK 284 T G G ++TL +Y++ +G G+A + +++ + A+ +R++ K Sbjct: 254 TGGGPGIQSQTLPLYMYEQAFSYGQLGYGTAVALMLLLVGGLAALAYLRVLPK 306 Lambda K H 0.328 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 310 Length adjustment: 27 Effective length of query: 261 Effective length of database: 283 Effective search space: 73863 Effective search space used: 73863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory